Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ETA12_RS12575 Genome accession   NZ_CP035399
Coordinates   2549791..2550168 (-) Length   125 a.a.
NCBI ID   WP_025649851.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM103788     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2544791..2555168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA12_RS12535 (ETA12_12535) - 2545288..2546082 (+) 795 WP_014305407.1 YqhG family protein -
  ETA12_RS12540 (ETA12_12540) sinI 2546259..2546432 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  ETA12_RS12545 (ETA12_12545) sinR 2546466..2546801 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ETA12_RS12550 (ETA12_12550) - 2546849..2547634 (-) 786 WP_017418136.1 TasA family protein -
  ETA12_RS12555 (ETA12_12555) - 2547699..2548283 (-) 585 WP_012117977.1 signal peptidase I -
  ETA12_RS12560 (ETA12_12560) tapA 2548255..2548926 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  ETA12_RS12565 (ETA12_12565) - 2549185..2549514 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ETA12_RS12570 (ETA12_12570) - 2549555..2549734 (-) 180 WP_003153093.1 YqzE family protein -
  ETA12_RS12575 (ETA12_12575) comGG 2549791..2550168 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  ETA12_RS12580 (ETA12_12580) comGF 2550169..2550564 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ETA12_RS12585 (ETA12_12585) comGE 2550578..2550892 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETA12_RS12590 (ETA12_12590) comGD 2550876..2551313 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETA12_RS12595 (ETA12_12595) comGC 2551303..2551611 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ETA12_RS12600 (ETA12_12600) comGB 2551616..2552653 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETA12_RS12605 (ETA12_12605) comGA 2552640..2553710 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ETA12_RS12610 (ETA12_12610) - 2553903..2554855 (-) 953 Protein_2430 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14151.04 Da        Isoelectric Point: 9.6404

>NTDB_id=340022 ETA12_RS12575 WP_025649851.1 2549791..2550168(-) (comGG) [Bacillus velezensis strain SRCM103788]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FYITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=340022 ETA12_RS12575 WP_025649851.1 2549791..2550168(-) (comGG) [Bacillus velezensis strain SRCM103788]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTTACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

52.419

99.2

0.52


Multiple sequence alignment