Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ETA12_RS12540 Genome accession   NZ_CP035399
Coordinates   2546259..2546432 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM103788     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2541259..2551432
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA12_RS12525 (ETA12_12525) gcvT 2542072..2543172 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  ETA12_RS12530 (ETA12_12530) - 2543596..2545266 (+) 1671 WP_017418135.1 SNF2-related protein -
  ETA12_RS12535 (ETA12_12535) - 2545288..2546082 (+) 795 WP_014305407.1 YqhG family protein -
  ETA12_RS12540 (ETA12_12540) sinI 2546259..2546432 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  ETA12_RS12545 (ETA12_12545) sinR 2546466..2546801 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ETA12_RS12550 (ETA12_12550) - 2546849..2547634 (-) 786 WP_017418136.1 TasA family protein -
  ETA12_RS12555 (ETA12_12555) - 2547699..2548283 (-) 585 WP_012117977.1 signal peptidase I -
  ETA12_RS12560 (ETA12_12560) tapA 2548255..2548926 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  ETA12_RS12565 (ETA12_12565) - 2549185..2549514 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ETA12_RS12570 (ETA12_12570) - 2549555..2549734 (-) 180 WP_003153093.1 YqzE family protein -
  ETA12_RS12575 (ETA12_12575) comGG 2549791..2550168 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  ETA12_RS12580 (ETA12_12580) comGF 2550169..2550564 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ETA12_RS12585 (ETA12_12585) comGE 2550578..2550892 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETA12_RS12590 (ETA12_12590) comGD 2550876..2551313 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=340020 ETA12_RS12540 WP_014418369.1 2546259..2546432(+) (sinI) [Bacillus velezensis strain SRCM103788]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=340020 ETA12_RS12540 WP_014418369.1 2546259..2546432(+) (sinI) [Bacillus velezensis strain SRCM103788]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterProScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment