Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ES966_RS15910 Genome accession   NZ_CP035393
Coordinates   3173397..3173537 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM103691     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3168397..3178537
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES966_RS15885 (ES966_15885) - 3168694..3169077 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ES966_RS15890 (ES966_15890) comA 3169099..3169743 (-) 645 WP_129093769.1 response regulator transcription factor Regulator
  ES966_RS15895 (ES966_15895) comP 3169824..3172127 (-) 2304 WP_070082286.1 histidine kinase Regulator
  ES966_RS15900 (ES966_15900) comX 3172147..3172326 (-) 180 WP_318010531.1 competence pheromone ComX -
  ES966_RS15905 (ES966_15905) comQ 3172280..3173266 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ES966_RS15910 (ES966_15910) degQ 3173397..3173537 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ES966_RS15920 (ES966_15920) - 3174002..3174343 (+) 342 WP_021495366.1 hypothetical protein -
  ES966_RS15925 (ES966_15925) - 3174350..3175573 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ES966_RS15930 (ES966_15930) - 3175703..3177169 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ES966_RS15935 (ES966_15935) - 3177187..3177738 (-) 552 WP_017419426.1 isochorismatase family cysteine hydrolase -
  ES966_RS15940 (ES966_15940) - 3177835..3178233 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=339724 ES966_RS15910 WP_003152043.1 3173397..3173537(-) (degQ) [Bacillus velezensis strain SRCM103691]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=339724 ES966_RS15910 WP_003152043.1 3173397..3173537(-) (degQ) [Bacillus velezensis strain SRCM103691]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment