Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   ESP48_RS03300 Genome accession   NZ_CP035306
Coordinates   621570..622646 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain IDCC2201     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 606825..679625 621570..622646 within 0


Gene organization within MGE regions


Location: 606825..679625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ESP48_RS03230 (ESP48_03230) - 607716..608267 (-) 552 WP_002946999.1 cysteine hydrolase family protein -
  ESP48_RS03235 (ESP48_03235) codY 608330..609115 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  ESP48_RS03240 (ESP48_03240) - 609375..610589 (-) 1215 WP_002951721.1 pyridoxal phosphate-dependent aminotransferase -
  ESP48_RS03245 (ESP48_03245) - 610944..611396 (+) 453 WP_002946987.1 universal stress protein -
  ESP48_RS10055 (ESP48_03250) - 611576..612147 (+) 572 Protein_620 IS30 family transposase -
  ESP48_RS09670 - 612219..612392 (-) 174 WP_014621904.1 hypothetical protein -
  ESP48_RS03255 (ESP48_03255) - 612453..612827 (-) 375 WP_011681547.1 membrane protein -
  ESP48_RS03260 (ESP48_03260) pflA 613039..613839 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  ESP48_RS09675 - 614027..614137 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  ESP48_RS03270 (ESP48_03270) - 614835..616166 (-) 1332 WP_002951727.1 hemolysin family protein -
  ESP48_RS03275 (ESP48_03275) - 616278..617060 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  ESP48_RS03280 (ESP48_03280) - 617682..619748 (-) 2067 WP_064355828.1 cation:proton antiporter -
  ESP48_RS03285 (ESP48_03285) - 619757..619999 (-) 243 WP_011226461.1 hypothetical protein -
  ESP48_RS03290 (ESP48_03290) - 619996..620544 (-) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  ESP48_RS03295 (ESP48_03295) - 620541..621485 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  ESP48_RS03300 (ESP48_03300) sepM 621570..622646 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  ESP48_RS03305 (ESP48_03305) coaD 622624..623121 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  ESP48_RS03310 (ESP48_03310) rsmD 623155..623694 (-) 540 WP_002951741.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  ESP48_RS03315 (ESP48_03315) trxB 623845..624765 (-) 921 WP_011226467.1 thioredoxin-disulfide reductase -
  ESP48_RS03320 (ESP48_03320) - 624831..625055 (-) 225 WP_002951743.1 DUF4059 family protein -
  ESP48_RS03325 (ESP48_03325) - 625270..626013 (-) 744 WP_011681551.1 amino acid ABC transporter ATP-binding protein -
  ESP48_RS03330 (ESP48_03330) - 626013..626759 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  ESP48_RS03335 (ESP48_03335) - 627147..627977 (-) 831 WP_014608653.1 transporter substrate-binding domain-containing protein -
  ESP48_RS03340 (ESP48_03340) - 628437..628670 (-) 234 WP_002947030.1 hypothetical protein -
  ESP48_RS03345 (ESP48_03345) dinB 628968..630071 (-) 1104 WP_014608654.1 DNA polymerase IV -
  ESP48_RS03350 (ESP48_03350) pflB 630350..632659 (+) 2310 WP_011226473.1 formate C-acetyltransferase -
  ESP48_RS03355 (ESP48_03355) - 632926..633708 (+) 783 WP_011681555.1 carbonic anhydrase -
  ESP48_RS03360 (ESP48_03360) - 633759..634211 (+) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  ESP48_RS03370 (ESP48_03370) - 634562..634846 (-) 285 WP_014608656.1 restriction endonuclease subunit S -
  ESP48_RS10480 (ESP48_03375) mobV 634892..635400 (-) 509 Protein_645 MobV family relaxase -
  ESP48_RS03380 (ESP48_03380) - 635845..636600 (-) 756 WP_011681558.1 ABC transporter permease -
  ESP48_RS03385 (ESP48_03385) - 636597..637247 (-) 651 WP_024703990.1 ABC transporter ATP-binding protein -
  ESP48_RS03390 (ESP48_03390) - 637450..638406 (-) 957 WP_024703991.1 serine hydrolase domain-containing protein -
  ESP48_RS03395 (ESP48_03395) - 638406..639161 (-) 756 WP_064355831.1 CppA family protein -
  ESP48_RS03400 (ESP48_03400) - 639443..639805 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  ESP48_RS03405 (ESP48_03405) gla 639892..640755 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  ESP48_RS03410 (ESP48_03410) - 640876..643143 (+) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  ESP48_RS03415 (ESP48_03415) - 643223..643603 (-) 381 WP_064355833.1 hypothetical protein -
  ESP48_RS03420 (ESP48_03420) - 643728..643991 (-) 264 WP_002945924.1 hypothetical protein -
  ESP48_RS03425 (ESP48_03425) - 644313..644609 (-) 297 WP_064355835.1 bacteriocin immunity protein -
  ESP48_RS10610 (ESP48_03430) - 644774..644980 (-) 207 WP_011681562.1 hypothetical protein -
  ESP48_RS03435 (ESP48_03435) - 645011..645658 (-) 648 WP_231079884.1 thioredoxin family protein -
  ESP48_RS03440 (ESP48_03440) - 645893..647463 (+) 1571 WP_128887979.1 IS3-like element ISSth1b family transposase -
  ESP48_RS03445 (ESP48_03445) - 647609..647863 (-) 255 WP_014608660.1 Blp family class II bacteriocin -
  ESP48_RS10485 (ESP48_03450) - 648114..648515 (-) 402 WP_024703992.1 hypothetical protein -
  ESP48_RS03460 (ESP48_03460) - 649520..649750 (-) 231 WP_014608662.1 bacteriocin class II family protein -
  ESP48_RS03465 (ESP48_03465) - 650106..650306 (-) 201 WP_011681569.1 hypothetical protein -
  ESP48_RS03470 (ESP48_03470) - 650325..650501 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  ESP48_RS03475 (ESP48_03475) - 650757..651494 (+) 738 WP_064356014.1 LytR/AlgR family response regulator transcription factor -
  ESP48_RS10065 - 652025..652828 (+) 804 WP_223899638.1 ATP-binding protein -
  ESP48_RS03485 (ESP48_03485) - 652846..653007 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  ESP48_RS03490 (ESP48_03490) - 653022..654389 (-) 1368 WP_064356015.1 bacteriocin secretion accessory protein -
  ESP48_RS03495 (ESP48_03495) comA/nlmT 654405..656558 (-) 2154 WP_041827378.1 peptide cleavage/export ABC transporter Regulator
  ESP48_RS03510 (ESP48_03510) - 657572..659317 (-) 1746 WP_014621922.1 ABC transporter ATP-binding protein -
  ESP48_RS03515 (ESP48_03515) - 659310..661067 (-) 1758 WP_014608668.1 ABC transporter ATP-binding protein -
  ESP48_RS10070 (ESP48_03520) - 661255..661461 (-) 207 WP_002948879.1 hypothetical protein -
  ESP48_RS03525 (ESP48_03525) - 661666..662193 (-) 528 WP_011226503.1 VanZ family protein -
  ESP48_RS03530 (ESP48_03530) rlmN 662195..663364 (-) 1170 WP_064356075.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  ESP48_RS03535 (ESP48_03535) - 663368..664090 (-) 723 WP_011226505.1 YutD family protein -
  ESP48_RS03540 (ESP48_03540) - 664145..665500 (-) 1356 WP_041827845.1 bifunctional metallophosphatase/5'-nucleotidase -
  ESP48_RS10410 - 665779..665910 (-) 132 WP_258380174.1 hypothetical protein -
  ESP48_RS03545 (ESP48_03545) - 666349..667692 (-) 1344 WP_011681583.1 DEAD/DEAH box helicase -
  ESP48_RS03550 (ESP48_03550) mraY 667767..668789 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  ESP48_RS03555 (ESP48_03555) pbp2X 668791..671058 (-) 2268 WP_064356077.1 penicillin-binding protein PBP2X -
  ESP48_RS03560 (ESP48_03560) ftsL 671062..671382 (-) 321 WP_014608671.1 cell division protein FtsL -
  ESP48_RS03565 (ESP48_03565) rsmH 671385..672335 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  ESP48_RS10075 (ESP48_03570) - 672502..672930 (-) 429 WP_064356079.1 hypothetical protein -
  ESP48_RS10080 - 672896..673237 (-) 342 WP_231079881.1 hypothetical protein -
  ESP48_RS10085 - 673715..673858 (-) 144 WP_014621937.1 hypothetical protein -
  ESP48_RS03590 (ESP48_03590) - 674132..674488 (-) 357 WP_014621938.1 DUF805 domain-containing protein -
  ESP48_RS03595 (ESP48_03595) - 674708..674998 (-) 291 WP_014621939.1 hypothetical protein -
  ESP48_RS03600 (ESP48_03600) - 675332..676582 (-) 1251 WP_014621940.1 glutamate-5-semialdehyde dehydrogenase -
  ESP48_RS03605 (ESP48_03605) proB 676584..677387 (-) 804 WP_014621941.1 glutamate 5-kinase -
  ESP48_RS03610 (ESP48_03610) - 677508..679097 (-) 1590 WP_014608677.1 ABC transporter permease -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=339165 ESP48_RS03300 WP_011681549.1 621570..622646(-) (sepM) [Streptococcus thermophilus strain IDCC2201]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=339165 ESP48_RS03300 WP_011681549.1 621570..622646(-) (sepM) [Streptococcus thermophilus strain IDCC2201]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598


Multiple sequence alignment