Detailed information    

insolico Bioinformatically predicted

Overview


Name   clpX   Type   Regulator
Locus tag   EQH28_RS07355 Genome accession   NZ_CP035252
Coordinates   1460020..1461252 (-) Length   410 a.a.
NCBI ID   WP_000106346.1    Uniprot ID   A0A064C077
Organism   Streptococcus pneumoniae strain TVO_1901934     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1415464..1470313 1460020..1461252 within 0


Gene organization within MGE regions


Location: 1415464..1470313
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH28_RS07030 (EQH28_07475) lytA 1415464..1416420 (-) 957 WP_000350486.1 N-acetylmuramoyl-L-alanine amidase LytA -
  EQH28_RS07035 (EQH28_07480) - 1416424..1416756 (-) 333 WP_001186242.1 phage holin -
  EQH28_RS07040 (EQH28_07485) - 1416760..1417176 (-) 417 WP_057519042.1 phage holin family protein -
  EQH28_RS07045 (EQH28_07490) - 1417186..1417536 (-) 351 WP_000852249.1 hypothetical protein -
  EQH28_RS07050 (EQH28_07495) - 1417539..1417742 (-) 204 WP_044793701.1 hypothetical protein -
  EQH28_RS07055 - 1417723..1417839 (-) 117 WP_001063633.1 hypothetical protein -
  EQH28_RS07060 - 1417836..1423442 (-) 5607 WP_238122307.1 tail fiber domain-containing protein -
  EQH28_RS07065 (EQH28_07515) - 1423447..1423797 (-) 351 WP_000068026.1 DUF6711 family protein -
  EQH28_RS07070 (EQH28_07520) - 1423806..1427459 (-) 3654 WP_088834556.1 hypothetical protein -
  EQH28_RS07075 (EQH28_07525) - 1427446..1427796 (-) 351 WP_000478010.1 hypothetical protein -
  EQH28_RS07080 (EQH28_07530) - 1427835..1428215 (-) 381 WP_001185635.1 DUF6096 family protein -
  EQH28_RS07085 (EQH28_07535) - 1428220..1428633 (-) 414 WP_000880678.1 phage tail tube protein -
  EQH28_RS07090 (EQH28_07540) - 1428636..1429004 (-) 369 WP_000608233.1 hypothetical protein -
  EQH28_RS07095 (EQH28_07545) - 1429001..1429516 (-) 516 WP_000015941.1 HK97-gp10 family putative phage morphogenesis protein -
  EQH28_RS07100 (EQH28_07550) - 1429491..1429829 (-) 339 WP_000478943.1 hypothetical protein -
  EQH28_RS07105 (EQH28_07555) - 1429810..1430121 (-) 312 WP_000021219.1 phage head-tail connector protein -
  EQH28_RS07110 (EQH28_07560) - 1430123..1430311 (-) 189 WP_000669349.1 hypothetical protein -
  EQH28_RS07115 (EQH28_07565) - 1430301..1430483 (-) 183 WP_000054934.1 Rho termination factor N-terminal domain-containing protein -
  EQH28_RS07120 (EQH28_07570) - 1430495..1431340 (-) 846 WP_000123890.1 N4-gp56 family major capsid protein -
  EQH28_RS07125 (EQH28_07575) - 1431347..1431931 (-) 585 WP_001288024.1 DUF4355 domain-containing protein -
  EQH28_RS07130 (EQH28_07580) - 1432101..1432313 (-) 213 WP_000393349.1 crAss001_48 related protein -
  EQH28_RS07135 - 1432458..1432631 (-) 174 WP_000379086.1 hypothetical protein -
  EQH28_RS07140 (EQH28_07585) - 1432782..1434332 (-) 1551 WP_179127978.1 minor capsid protein -
  EQH28_RS07145 (EQH28_07590) - 1434241..1435710 (-) 1470 WP_088834552.1 phage portal protein -
  EQH28_RS07150 (EQH28_07595) - 1435722..1437020 (-) 1299 WP_238122309.1 PBSX family phage terminase large subunit -
  EQH28_RS07155 (EQH28_07600) - 1436998..1437438 (-) 441 WP_014931818.1 terminase small subunit -
  EQH28_RS07165 (EQH28_07605) - 1437912..1438334 (-) 423 WP_001030244.1 DUF1492 domain-containing protein -
  EQH28_RS07170 (EQH28_07610) - 1438404..1438775 (-) 372 WP_001247151.1 hypothetical protein -
  EQH28_RS07175 (EQH28_07615) - 1438772..1439209 (-) 438 WP_000612395.1 YopX family protein -
  EQH28_RS07180 (EQH28_07625) - 1439322..1439780 (-) 459 WP_000340952.1 hypothetical protein -
  EQH28_RS07185 (EQH28_07630) - 1439780..1440040 (-) 261 WP_000819330.1 DUF1372 family protein -
  EQH28_RS11230 - 1440037..1440159 (-) 123 WP_001842508.1 hypothetical protein -
  EQH28_RS07190 (EQH28_07635) - 1440198..1440893 (-) 696 WP_061364775.1 DUF1642 domain-containing protein -
  EQH28_RS07195 - 1440890..1441045 (-) 156 WP_000122744.1 hypothetical protein -
  EQH28_RS07200 (EQH28_07640) - 1441345..1442682 (-) 1338 WP_016397659.1 virulence-associated E family protein -
  EQH28_RS07205 (EQH28_07645) - 1442685..1443506 (-) 822 WP_001139684.1 bifunctional DNA primase/polymerase -
  EQH28_RS07210 (EQH28_07650) - 1443679..1444182 (-) 504 WP_000054339.1 hypothetical protein -
  EQH28_RS07215 (EQH28_07655) - 1444202..1445029 (-) 828 WP_000885997.1 AAA family ATPase -
  EQH28_RS07220 (EQH28_07660) - 1445029..1445346 (-) 318 WP_001044592.1 hypothetical protein -
  EQH28_RS07225 (EQH28_07665) - 1445365..1446558 (-) 1194 WP_000028858.1 DEAD/DEAH box helicase family protein -
  EQH28_RS07230 (EQH28_07670) - 1446521..1447006 (-) 486 WP_238122311.1 hypothetical protein -
  EQH28_RS07235 (EQH28_07675) - 1447006..1447356 (-) 351 WP_224757118.1 hypothetical protein -
  EQH28_RS07240 (EQH28_07680) - 1447365..1447847 (-) 483 WP_000157806.1 siphovirus Gp157 family protein -
  EQH28_RS07245 (EQH28_07685) - 1447840..1448562 (-) 723 WP_000544341.1 HNH endonuclease signature motif containing protein -
  EQH28_RS07250 (EQH28_07690) - 1448576..1448806 (-) 231 WP_000252078.1 hypothetical protein -
  EQH28_RS07255 (EQH28_07695) - 1448807..1449148 (-) 342 WP_000189406.1 hypothetical protein -
  EQH28_RS07260 (EQH28_07700) - 1449160..1449348 (-) 189 WP_000455779.1 hypothetical protein -
  EQH28_RS07265 (EQH28_07705) - 1449327..1449542 (-) 216 WP_001050925.1 hypothetical protein -
  EQH28_RS07270 (EQH28_07710) - 1449539..1449811 (-) 273 WP_000388508.1 hypothetical protein -
  EQH28_RS07275 (EQH28_07715) - 1449929..1450168 (+) 240 WP_000134993.1 hypothetical protein -
  EQH28_RS07280 - 1450161..1450331 (-) 171 WP_000656631.1 hypothetical protein -
  EQH28_RS07285 - 1450328..1450471 (-) 144 WP_000389590.1 hypothetical protein -
  EQH28_RS07290 (EQH28_07720) - 1450590..1450781 (+) 192 WP_000834563.1 hypothetical protein -
  EQH28_RS07295 - 1451180..1451380 (-) 201 WP_000446708.1 hypothetical protein -
  EQH28_RS07300 (EQH28_07730) - 1451412..1451627 (-) 216 WP_001198773.1 helix-turn-helix transcriptional regulator -
  EQH28_RS07305 - 1451646..1451810 (-) 165 WP_000662050.1 hypothetical protein -
  EQH28_RS11235 - 1451826..1451960 (-) 135 WP_001247818.1 hypothetical protein -
  EQH28_RS07310 (EQH28_07735) - 1452017..1452706 (+) 690 WP_000577515.1 DUF4145 domain-containing protein -
  EQH28_RS07315 (EQH28_07740) - 1452950..1453741 (+) 792 WP_000343639.1 XRE family transcriptional regulator -
  EQH28_RS07320 (EQH28_07745) - 1453890..1454840 (+) 951 WP_000802056.1 Abi family protein -
  EQH28_RS07325 (EQH28_07750) - 1454994..1456121 (+) 1128 WP_016397644.1 site-specific integrase -
  EQH28_RS07330 (EQH28_07755) whiA 1456209..1457120 (-) 912 WP_000011293.1 DNA-binding protein WhiA -
  EQH28_RS07335 (EQH28_07760) - 1457117..1458094 (-) 978 WP_001231086.1 YvcK family protein -
  EQH28_RS07340 (EQH28_07765) rapZ 1458091..1458981 (-) 891 WP_000163031.1 RNase adapter RapZ -
  EQH28_RS07345 (EQH28_07770) - 1459033..1459413 (-) 381 WP_001140412.1 RidA family protein -
  EQH28_RS07350 (EQH28_07775) yihA 1459424..1460011 (-) 588 WP_000422599.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  EQH28_RS07355 (EQH28_07780) clpX 1460020..1461252 (-) 1233 WP_000106346.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  EQH28_RS07360 (EQH28_07785) - 1461284..1461454 (-) 171 WP_000442275.1 hypothetical protein -
  EQH28_RS07365 (EQH28_07790) - 1461454..1461960 (-) 507 WP_000162503.1 dihydrofolate reductase -
  EQH28_RS07370 (EQH28_07795) - 1462090..1462608 (-) 519 WP_000229874.1 DNA starvation/stationary phase protection protein -
  EQH28_RS07375 (EQH28_07800) lytC 1463104..1464609 (-) 1506 WP_075271359.1 choline binding-anchored murein hydrolase LytC -
  EQH28_RS07380 (EQH28_07805) tpiA 1464647..1465405 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  EQH28_RS07385 (EQH28_07810) - 1465503..1466180 (-) 678 WP_000221604.1 DnaD domain-containing protein -
  EQH28_RS07390 (EQH28_07815) metA 1466189..1467133 (-) 945 WP_001122713.1 homoserine O-succinyltransferase -
  EQH28_RS07395 (EQH28_07820) - 1467315..1467827 (-) 513 WP_001049323.1 adenine phosphoribosyltransferase -
  EQH28_RS07400 (EQH28_07825) - 1467914..1468672 (-) 759 WP_001287234.1 class I SAM-dependent methyltransferase -
  EQH28_RS07405 (EQH28_07830) - 1469183..1470313 (-) 1131 WP_000229959.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 410 a.a.        Molecular weight: 45798.35 Da        Isoelectric Point: 4.4550

>NTDB_id=337835 EQH28_RS07355 WP_000106346.1 1460020..1461252(-) (clpX) [Streptococcus pneumoniae strain TVO_1901934]
MSTNRKNDMMVYCSFCGKNQEEVQKIIAGNNAFICNECVELAQEIIREELVEEVLADLSEVPKPIELLHILNHYVIGQDR
AKRALAVAVYNHYKRINFHDTREESEDVDLQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVEN
ILLKLLQVADFNIERAERGIIYVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDT
KNILFIVGGAFDGIEEIVKQRLGEKVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAALEQLTVDDLVR
ILKEPRNALVKQYQTLLSYDDVELEFDDEALQEIANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVD
GTDKPILETA

Nucleotide


Download         Length: 1233 bp        

>NTDB_id=337835 EQH28_RS07355 WP_000106346.1 1460020..1461252(-) (clpX) [Streptococcus pneumoniae strain TVO_1901934]
ATGTCTACAAATAGAAAAAATGATATGATGGTTTATTGCTCATTTTGTGGCAAAAACCAAGAAGAAGTACAAAAAATAAT
TGCTGGCAACAATGCTTTTATTTGTAATGAATGCGTGGAGTTAGCTCAGGAAATCATTCGAGAAGAATTGGTTGAGGAAG
TCTTGGCAGACTTGTCTGAGGTGCCAAAACCAATTGAACTCCTCCATATCTTGAACCACTATGTAATTGGTCAAGATCGT
GCCAAGCGTGCCTTGGCAGTGGCGGTTTATAATCACTACAAACGCATCAATTTCCACGATACACGCGAAGAGTCAGAAGA
TGTGGATTTGCAGAAGTCAAACATTTTGATGATTGGCCCAACTGGTTCAGGGAAAACTTTCCTTGCCCAGACCTTGGCTA
AGAGCTTGAATGTGCCTTTTGCTATTGCGGATGCGACAGCTCTGACGGAGGCTGGTTATGTGGGTGAGGATGTGGAAAAT
ATCCTCCTCAAACTCTTGCAGGTTGCTGACTTTAACATCGAACGTGCAGAGCGTGGCATTATCTATGTGGATGAAATTGA
CAAGATTGCCAAGAAGAGTGAGAATGTGTCTATCACACGTGATGTTTCTGGTGAAGGGGTGCAACAAGCCCTTCTCAAGA
TTATCGAGGGAACTGTTGCTAGCGTGCCGCCTCAAGGTGGACGCAAACATCCACAACAAGAGATGATTCAAGTGGATACA
AAAAATATCCTCTTCATCGTGGGTGGTGCTTTTGATGGTATTGAAGAAATTGTCAAACAACGTCTGGGTGAAAAAGTCAT
CGGATTTGGTCAAAACAATAAGGCGATTGACGAAAACAGCTCATACATGCAAGAAATCATCGCTGAAGACATTCAAAAAT
TTGGTATTATCCCTGAGTTGATTGGACGCTTGCCTGTTTTTGCGGCTCTTGAGCAATTGACCGTTGATGACTTGGTTCGC
ATCTTGAAAGAGCCAAGAAATGCCTTGGTGAAACAATACCAAACCTTGCTTTCTTATGATGATGTTGAGTTGGAATTTGA
CGACGAAGCCCTTCAAGAGATTGCTAATAAAGCAATCGAACGGAAGACAGGGGCGCGTGGACTTCGCTCCATTATCGAAG
AAACCATGCTAGATGTTATGTTTGAGGTGCCGAGTCAGGAAAATGTGAAATTGGTTCGCATCACTAAAGAAACTGTTGAT
GGAACGGATAAACCGATCCTAGAAACAGCCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A064C077

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

86.585

100

0.866

  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

57.214

98.049

0.561


Multiple sequence alignment