Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH29_RS02460 | Genome accession | NZ_CP035251 |
| Coordinates | 480793..480942 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain TVO_1901935 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 475793..485942
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH29_RS02440 (EQH29_02585) | comA/nlmT | 476860..478536 (-) | 1677 | WP_196300924.1 | peptide cleavage/export ABC transporter | Regulator |
| EQH29_RS10660 | comA/nlmT | 478430..479017 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQH29_RS02445 (EQH29_02590) | blpI | 479299..479496 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH29_RS02450 (EQH29_02600) | blpJ | 479963..480232 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| EQH29_RS02455 (EQH29_02605) | blpK | 480301..480549 (+) | 249 | WP_047475057.1 | bacteriocin-like peptide BlpK | - |
| EQH29_RS02460 (EQH29_02615) | cipB | 480793..480942 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH29_RS10775 | - | 480978..481043 (+) | 66 | Protein_490 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| EQH29_RS02465 (EQH29_02620) | - | 481046..481165 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH29_RS02470 (EQH29_02630) | - | 481646..482004 (+) | 359 | Protein_492 | immunity protein | - |
| EQH29_RS02475 (EQH29_02640) | - | 482633..483016 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| EQH29_RS02480 (EQH29_02645) | - | 483068..483757 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH29_RS02485 (EQH29_02650) | blpZ | 483799..484032 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| EQH29_RS02490 (EQH29_02660) | - | 484183..484794 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH29_RS02495 (EQH29_02665) | ccrZ | 484955..485749 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=337737 EQH29_RS02460 WP_001809846.1 480793..480942(+) (cipB) [Streptococcus pneumoniae strain TVO_1901935]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=337737 EQH29_RS02460 WP_001809846.1 480793..480942(+) (cipB) [Streptococcus pneumoniae strain TVO_1901935]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |