Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   EQH29_RS02460 Genome accession   NZ_CP035251
Coordinates   480793..480942 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain TVO_1901935     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 475793..485942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH29_RS02440 (EQH29_02585) comA/nlmT 476860..478536 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  EQH29_RS10660 comA/nlmT 478430..479017 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQH29_RS02445 (EQH29_02590) blpI 479299..479496 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  EQH29_RS02450 (EQH29_02600) blpJ 479963..480232 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  EQH29_RS02455 (EQH29_02605) blpK 480301..480549 (+) 249 WP_047475057.1 bacteriocin-like peptide BlpK -
  EQH29_RS02460 (EQH29_02615) cipB 480793..480942 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  EQH29_RS10775 - 480978..481043 (+) 66 Protein_490 ComC/BlpC family peptide pheromone/bacteriocin -
  EQH29_RS02465 (EQH29_02620) - 481046..481165 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  EQH29_RS02470 (EQH29_02630) - 481646..482004 (+) 359 Protein_492 immunity protein -
  EQH29_RS02475 (EQH29_02640) - 482633..483016 (+) 384 WP_000877381.1 hypothetical protein -
  EQH29_RS02480 (EQH29_02645) - 483068..483757 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  EQH29_RS02485 (EQH29_02650) blpZ 483799..484032 (+) 234 WP_000276498.1 immunity protein BlpZ -
  EQH29_RS02490 (EQH29_02660) - 484183..484794 (+) 612 WP_000394044.1 CPBP family intramembrane glutamic endopeptidase -
  EQH29_RS02495 (EQH29_02665) ccrZ 484955..485749 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=337737 EQH29_RS02460 WP_001809846.1 480793..480942(+) (cipB) [Streptococcus pneumoniae strain TVO_1901935]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=337737 EQH29_RS02460 WP_001809846.1 480793..480942(+) (cipB) [Streptococcus pneumoniae strain TVO_1901935]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment