Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH35_RS02615 | Genome accession | NZ_CP035245 |
| Coordinates | 496360..496509 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | A0A4J1ZTW6 |
| Organism | Streptococcus pneumoniae strain TVO_1901943 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 485868..495414 | 496360..496509 | flank | 946 |
Gene organization within MGE regions
Location: 485868..496509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH35_RS02555 (EQH35_02680) | - | 485868..486155 (-) | 288 | WP_000777760.1 | hypothetical protein | - |
| EQH35_RS02560 (EQH35_02685) | - | 486165..486575 (-) | 411 | WP_001278301.1 | HIT family protein | - |
| EQH35_RS02565 (EQH35_02690) | pptA | 486643..487374 (+) | 732 | WP_000889923.1 | ABC transporter ATP-binding protein | Regulator |
| EQH35_RS02570 (EQH35_02695) | - | 487371..488420 (+) | 1050 | WP_000653752.1 | ABC transporter permease | - |
| EQH35_RS02575 (EQH35_02700) | - | 488588..488917 (-) | 330 | WP_000132570.1 | hypothetical protein | - |
| EQH35_RS02580 (EQH35_02705) | - | 489195..489533 (+) | 339 | WP_000682119.1 | LytTR family DNA-binding domain-containing protein | - |
| EQH35_RS02585 (EQH35_02710) | comE/blpR | 489538..490275 (+) | 738 | WP_001219127.1 | response regulator transcription factor | Regulator |
| EQH35_RS02590 (EQH35_02715) | - | 490289..491629 (+) | 1341 | WP_001017622.1 | sensor histidine kinase | - |
| EQH35_RS02595 (EQH35_02720) | blpC | 491671..491826 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| EQH35_RS02600 (EQH35_02725) | - | 491883..493244 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| EQH35_RS10700 | comA/nlmT | 493255..493743 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQH35_RS10705 | comA/nlmT | 493727..494167 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQH35_RS10710 | comA/nlmT | 494157..494882 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| EQH35_RS10715 (EQH35_02735) | comA/nlmT | 494827..495414 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQH35_RS02610 (EQH35_02740) | blpI | 495696..495893 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| EQH35_RS02615 (EQH35_02750) | cipB | 496360..496509 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=337346 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=337346 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |