Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQH35_RS02615 Genome accession   NZ_CP035245
Coordinates   496360..496509 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae strain TVO_1901943     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 485868..495414 496360..496509 flank 946


Gene organization within MGE regions


Location: 485868..496509
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH35_RS02555 (EQH35_02680) - 485868..486155 (-) 288 WP_000777760.1 hypothetical protein -
  EQH35_RS02560 (EQH35_02685) - 486165..486575 (-) 411 WP_001278301.1 HIT family protein -
  EQH35_RS02565 (EQH35_02690) pptA 486643..487374 (+) 732 WP_000889923.1 ABC transporter ATP-binding protein Regulator
  EQH35_RS02570 (EQH35_02695) - 487371..488420 (+) 1050 WP_000653752.1 ABC transporter permease -
  EQH35_RS02575 (EQH35_02700) - 488588..488917 (-) 330 WP_000132570.1 hypothetical protein -
  EQH35_RS02580 (EQH35_02705) - 489195..489533 (+) 339 WP_000682119.1 LytTR family DNA-binding domain-containing protein -
  EQH35_RS02585 (EQH35_02710) comE/blpR 489538..490275 (+) 738 WP_001219127.1 response regulator transcription factor Regulator
  EQH35_RS02590 (EQH35_02715) - 490289..491629 (+) 1341 WP_001017622.1 sensor histidine kinase -
  EQH35_RS02595 (EQH35_02720) blpC 491671..491826 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  EQH35_RS02600 (EQH35_02725) - 491883..493244 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  EQH35_RS10700 comA/nlmT 493255..493743 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  EQH35_RS10705 comA/nlmT 493727..494167 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  EQH35_RS10710 comA/nlmT 494157..494882 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  EQH35_RS10715 (EQH35_02735) comA/nlmT 494827..495414 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQH35_RS02610 (EQH35_02740) blpI 495696..495893 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  EQH35_RS02615 (EQH35_02750) cipB 496360..496509 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=337346 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=337346 EQH35_RS02615 WP_001808912.1 496360..496509(+) (cipB) [Streptococcus pneumoniae strain TVO_1901943]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment