Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EQZ20_RS18820 Genome accession   NZ_CP035232
Coordinates   3639019..3639159 (-) Length   46 a.a.
NCBI ID   WP_046131692.1    Uniprot ID   -
Organism   Bacillus glycinifermentans strain SRCM103574     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3634019..3644159
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ20_RS18795 (EQZ20_18795) - 3634290..3634682 (-) 393 WP_046131688.1 hotdog fold thioesterase -
  EQZ20_RS18800 (EQZ20_18800) comA 3634702..3635340 (-) 639 WP_046131689.1 response regulator transcription factor Regulator
  EQZ20_RS18805 (EQZ20_18805) comP 3635423..3637741 (-) 2319 WP_046131690.1 ATP-binding protein Regulator
  EQZ20_RS18810 (EQZ20_18810) comX 3637782..3637946 (-) 165 WP_046131691.1 competence pheromone ComX -
  EQZ20_RS18815 (EQZ20_18815) - 3637957..3638829 (-) 873 WP_046131716.1 polyprenyl synthetase family protein -
  EQZ20_RS18820 (EQZ20_18820) degQ 3639019..3639159 (-) 141 WP_046131692.1 degradation enzyme regulation protein DegQ Regulator
  EQZ20_RS18825 (EQZ20_18825) - 3639652..3639999 (+) 348 WP_231947384.1 hypothetical protein -
  EQZ20_RS18830 (EQZ20_18830) - 3640050..3641267 (-) 1218 WP_046131693.1 HDOD domain-containing protein -
  EQZ20_RS18835 (EQZ20_18835) - 3641422..3642891 (-) 1470 WP_046131694.1 nicotinate phosphoribosyltransferase -
  EQZ20_RS18840 (EQZ20_18840) - 3642909..3643460 (-) 552 WP_046131695.1 cysteine hydrolase family protein -
  EQZ20_RS18845 (EQZ20_18845) - 3643598..3643990 (-) 393 WP_046131696.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5733.54 Da        Isoelectric Point: 8.4596

>NTDB_id=336550 EQZ20_RS18820 WP_046131692.1 3639019..3639159(-) (degQ) [Bacillus glycinifermentans strain SRCM103574]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYSYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=336550 EQZ20_RS18820 WP_046131692.1 3639019..3639159(-) (degQ) [Bacillus glycinifermentans strain SRCM103574]
GTGGAAAAGCAACAAATTGAAGAGTTAAAGCAATTGCTTTGGCGGCTTGAAAATGAAATCAGGGAAACGAAAGACTCCTT
GCGCAAGATTAACAAAAGTATCGACCAATATGATAAATACTCATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment