Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EQZ20_RS14670 Genome accession   NZ_CP035232
Coordinates   2851985..2852161 (+) Length   58 a.a.
NCBI ID   WP_046129962.1    Uniprot ID   A0A0J6E1Q0
Organism   Bacillus glycinifermentans strain SRCM103574     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2846985..2857161
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ20_RS14655 (EQZ20_14655) gcvT 2847660..2848754 (-) 1095 WP_046129959.1 glycine cleavage system aminomethyltransferase GcvT -
  EQZ20_RS14660 (EQZ20_14660) - 2849334..2851001 (+) 1668 WP_046129960.1 SNF2-related protein -
  EQZ20_RS14665 (EQZ20_14665) - 2851005..2851799 (+) 795 WP_046129961.1 YqhG family protein -
  EQZ20_RS14670 (EQZ20_14670) sinI 2851985..2852161 (+) 177 WP_046129962.1 anti-repressor SinI family protein Regulator
  EQZ20_RS14675 (EQZ20_14675) sinR 2852195..2852530 (+) 336 WP_096891855.1 transcriptional regulator SinR Regulator
  EQZ20_RS14680 (EQZ20_14680) - 2852634..2853428 (-) 795 WP_046129964.1 TasA family protein -
  EQZ20_RS14685 (EQZ20_14685) - 2853497..2854078 (-) 582 WP_046129965.1 signal peptidase I -
  EQZ20_RS14690 (EQZ20_14690) tapA 2854075..2854800 (-) 726 WP_046129966.1 amyloid fiber anchoring/assembly protein TapA -
  EQZ20_RS14695 (EQZ20_14695) - 2855063..2855386 (+) 324 WP_046129967.1 DUF3889 domain-containing protein -
  EQZ20_RS14700 (EQZ20_14700) - 2855471..2855653 (-) 183 WP_046129968.1 YqzE family protein -
  EQZ20_RS14705 (EQZ20_14705) comGG 2855735..2856100 (-) 366 WP_046129969.1 competence type IV pilus minor pilin ComGG -
  EQZ20_RS14710 (EQZ20_14710) comGF 2856112..2856597 (-) 486 WP_082094061.1 competence type IV pilus minor pilin ComGF -
  EQZ20_RS14715 (EQZ20_14715) comGE 2856512..2856859 (-) 348 WP_046129970.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6708.47 Da        Isoelectric Point: 4.4545

>NTDB_id=336531 EQZ20_RS14670 WP_046129962.1 2851985..2852161(+) (sinI) [Bacillus glycinifermentans strain SRCM103574]
MNKVEHEKEELDKEWEELIKSALNEGISPEEIRIFLNLGNKTSEASTPIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=336531 EQZ20_RS14670 WP_046129962.1 2851985..2852161(+) (sinI) [Bacillus glycinifermentans strain SRCM103574]
ATGAATAAAGTGGAACATGAGAAAGAAGAATTGGACAAGGAGTGGGAAGAGCTGATCAAAAGTGCTCTCAATGAAGGCAT
TAGTCCGGAAGAAATAAGAATATTTCTCAATTTAGGAAATAAGACTTCCGAAGCTTCCACACCAATTGAAAGAAGTCATT
CAATAAATCCCTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0J6E1Q0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment