Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   BCA_RS10995 Genome accession   NC_012472
Coordinates   1934720..1935007 (+) Length   95 a.a.
NCBI ID   WP_000648331.1    Uniprot ID   A0A2A8KZX2
Organism   Bacillus cereus 03BB102     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1911458..1935007 1934720..1935007 within 0


Gene organization within MGE regions


Location: 1911458..1935007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BCA_RS10860 (BCA_2053) - 1911458..1911625 (+) 168 WP_000816382.1 DUF3933 family protein -
  BCA_RS10865 (BCA_2054) - 1911734..1912699 (-) 966 WP_000686814.1 patatin-like phospholipase family protein -
  BCA_RS10870 (BCA_2055) - 1912787..1912927 (-) 141 WP_000540419.1 YjcZ family sporulation protein -
  BCA_RS10875 (BCA_2056) - 1913151..1913903 (+) 753 WP_001041252.1 YwqG family protein -
  BCA_RS10880 (BCA_2057) - 1914050..1915210 (+) 1161 WP_000520824.1 transglutaminase domain-containing protein -
  BCA_RS10885 (BCA_2058) - 1915314..1915512 (+) 199 Protein_1883 DUF4083 domain-containing protein -
  BCA_RS10890 (BCA_2059) - 1915544..1916005 (+) 462 WP_000024996.1 NUDIX hydrolase -
  BCA_RS10895 (BCA_2060) nadE 1916052..1916870 (-) 819 WP_000174886.1 ammonia-dependent NAD(+) synthetase -
  BCA_RS10900 (BCA_2061) - 1917074..1918423 (-) 1350 WP_000120811.1 SIR2 family NAD-dependent protein deacylase -
  BCA_RS10905 (BCA_2062) - 1918463..1919266 (-) 804 WP_000711252.1 helix-turn-helix domain-containing protein -
  BCA_RS10910 (BCA_2063) - 1919537..1920013 (+) 477 WP_000910214.1 hypothetical protein -
  BCA_RS10915 (BCA_2064) - 1920073..1920402 (+) 330 WP_000101749.1 hypothetical protein -
  BCA_RS10920 (BCA_2065) - 1920557..1921015 (+) 459 WP_000505996.1 hypothetical protein -
  BCA_RS30570 (BCA_2066) - 1921679..1921843 (+) 165 WP_000730209.1 hypothetical protein -
  BCA_RS10925 (BCA_2067) - 1921912..1922889 (+) 978 WP_000913043.1 hypothetical protein -
  BCA_RS10930 (BCA_2068) - 1923036..1923236 (+) 201 WP_000395016.1 hypothetical protein -
  BCA_RS10935 (BCA_2069) - 1923392..1923571 (+) 180 WP_000694777.1 hypothetical protein -
  BCA_RS10940 (BCA_2070) - 1923619..1924605 (+) 987 WP_000917086.1 hypothetical protein -
  BCA_RS10945 (BCA_2071) - 1924971..1925267 (+) 297 WP_041926376.1 hypothetical protein -
  BCA_RS28450 (BCA_2072) - 1925402..1925872 (+) 471 WP_001118332.1 phage terminase small subunit P27 family -
  BCA_RS10955 (BCA_2073) - 1925873..1926196 (+) 324 WP_000349668.1 hypothetical protein -
  BCA_RS10960 (BCA_2074) - 1926212..1927513 (+) 1302 WP_000522351.1 phage portal protein -
  BCA_RS10965 (BCA_2075) - 1927491..1929179 (+) 1689 WP_000781513.1 phage major capsid protein -
  BCA_RS10970 (BCA_2076) - 1929322..1929630 (-) 309 WP_000443340.1 hypothetical protein -
  BCA_RS10975 (BCA_2077) - 1929860..1930081 (+) 222 WP_000799106.1 hypothetical protein -
  BCA_RS10980 (BCA_2078) - 1930175..1931680 (+) 1506 WP_000804003.1 recombinase family protein -
  BCA_RS10985 (BCA_2079) - 1931765..1932442 (-) 678 WP_000639411.1 hypothetical protein -
  BCA_RS10990 (BCA_2080) - 1932724..1934604 (+) 1881 WP_001026014.1 FtsX-like permease family protein -
  BCA_RS10995 (BCA_2081) abrB 1934720..1935007 (+) 288 WP_000648331.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator

Sequence


Protein


Download         Length: 95 a.a.        Molecular weight: 10645.40 Da        Isoelectric Point: 6.3179

>NTDB_id=33576 BCA_RS10995 WP_000648331.1 1934720..1935007(+) (abrB) [Bacillus cereus 03BB102]
MKATGVIRKVDELGRIVIPKELRDVLGIQIKSPLEIFVEEDKVILQKYQPYNACQITGDVSNQNISLANGNITVSIDGAK
YLIKEIEKFLNKSEV

Nucleotide


Download         Length: 288 bp        

>NTDB_id=33576 BCA_RS10995 WP_000648331.1 1934720..1935007(+) (abrB) [Bacillus cereus 03BB102]
ATGAAAGCAACAGGAGTTATTCGAAAAGTAGACGAATTAGGACGAATTGTTATTCCTAAAGAATTACGTGATGTATTGGG
AATACAAATCAAATCACCGCTTGAAATTTTCGTAGAAGAAGACAAAGTCATTTTACAAAAATATCAACCTTACAATGCTT
GTCAAATAACAGGTGATGTTTCAAATCAAAACATATCATTAGCAAATGGAAACATTACTGTTAGTATAGATGGAGCGAAA
TATTTAATAAAAGAAATAGAGAAGTTTTTAAACAAGAGTGAGGTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.444

94.737

0.516


Multiple sequence alignment