Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BCA_RS10995 | Genome accession | NC_012472 |
| Coordinates | 1934720..1935007 (+) | Length | 95 a.a. |
| NCBI ID | WP_000648331.1 | Uniprot ID | A0A2A8KZX2 |
| Organism | Bacillus cereus 03BB102 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1911458..1935007 | 1934720..1935007 | within | 0 |
Gene organization within MGE regions
Location: 1911458..1935007
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BCA_RS10860 (BCA_2053) | - | 1911458..1911625 (+) | 168 | WP_000816382.1 | DUF3933 family protein | - |
| BCA_RS10865 (BCA_2054) | - | 1911734..1912699 (-) | 966 | WP_000686814.1 | patatin-like phospholipase family protein | - |
| BCA_RS10870 (BCA_2055) | - | 1912787..1912927 (-) | 141 | WP_000540419.1 | YjcZ family sporulation protein | - |
| BCA_RS10875 (BCA_2056) | - | 1913151..1913903 (+) | 753 | WP_001041252.1 | YwqG family protein | - |
| BCA_RS10880 (BCA_2057) | - | 1914050..1915210 (+) | 1161 | WP_000520824.1 | transglutaminase domain-containing protein | - |
| BCA_RS10885 (BCA_2058) | - | 1915314..1915512 (+) | 199 | Protein_1883 | DUF4083 domain-containing protein | - |
| BCA_RS10890 (BCA_2059) | - | 1915544..1916005 (+) | 462 | WP_000024996.1 | NUDIX hydrolase | - |
| BCA_RS10895 (BCA_2060) | nadE | 1916052..1916870 (-) | 819 | WP_000174886.1 | ammonia-dependent NAD(+) synthetase | - |
| BCA_RS10900 (BCA_2061) | - | 1917074..1918423 (-) | 1350 | WP_000120811.1 | SIR2 family NAD-dependent protein deacylase | - |
| BCA_RS10905 (BCA_2062) | - | 1918463..1919266 (-) | 804 | WP_000711252.1 | helix-turn-helix domain-containing protein | - |
| BCA_RS10910 (BCA_2063) | - | 1919537..1920013 (+) | 477 | WP_000910214.1 | hypothetical protein | - |
| BCA_RS10915 (BCA_2064) | - | 1920073..1920402 (+) | 330 | WP_000101749.1 | hypothetical protein | - |
| BCA_RS10920 (BCA_2065) | - | 1920557..1921015 (+) | 459 | WP_000505996.1 | hypothetical protein | - |
| BCA_RS30570 (BCA_2066) | - | 1921679..1921843 (+) | 165 | WP_000730209.1 | hypothetical protein | - |
| BCA_RS10925 (BCA_2067) | - | 1921912..1922889 (+) | 978 | WP_000913043.1 | hypothetical protein | - |
| BCA_RS10930 (BCA_2068) | - | 1923036..1923236 (+) | 201 | WP_000395016.1 | hypothetical protein | - |
| BCA_RS10935 (BCA_2069) | - | 1923392..1923571 (+) | 180 | WP_000694777.1 | hypothetical protein | - |
| BCA_RS10940 (BCA_2070) | - | 1923619..1924605 (+) | 987 | WP_000917086.1 | hypothetical protein | - |
| BCA_RS10945 (BCA_2071) | - | 1924971..1925267 (+) | 297 | WP_041926376.1 | hypothetical protein | - |
| BCA_RS28450 (BCA_2072) | - | 1925402..1925872 (+) | 471 | WP_001118332.1 | phage terminase small subunit P27 family | - |
| BCA_RS10955 (BCA_2073) | - | 1925873..1926196 (+) | 324 | WP_000349668.1 | hypothetical protein | - |
| BCA_RS10960 (BCA_2074) | - | 1926212..1927513 (+) | 1302 | WP_000522351.1 | phage portal protein | - |
| BCA_RS10965 (BCA_2075) | - | 1927491..1929179 (+) | 1689 | WP_000781513.1 | phage major capsid protein | - |
| BCA_RS10970 (BCA_2076) | - | 1929322..1929630 (-) | 309 | WP_000443340.1 | hypothetical protein | - |
| BCA_RS10975 (BCA_2077) | - | 1929860..1930081 (+) | 222 | WP_000799106.1 | hypothetical protein | - |
| BCA_RS10980 (BCA_2078) | - | 1930175..1931680 (+) | 1506 | WP_000804003.1 | recombinase family protein | - |
| BCA_RS10985 (BCA_2079) | - | 1931765..1932442 (-) | 678 | WP_000639411.1 | hypothetical protein | - |
| BCA_RS10990 (BCA_2080) | - | 1932724..1934604 (+) | 1881 | WP_001026014.1 | FtsX-like permease family protein | - |
| BCA_RS10995 (BCA_2081) | abrB | 1934720..1935007 (+) | 288 | WP_000648331.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
Sequence
Protein
Download Length: 95 a.a. Molecular weight: 10645.40 Da Isoelectric Point: 6.3179
>NTDB_id=33576 BCA_RS10995 WP_000648331.1 1934720..1935007(+) (abrB) [Bacillus cereus 03BB102]
MKATGVIRKVDELGRIVIPKELRDVLGIQIKSPLEIFVEEDKVILQKYQPYNACQITGDVSNQNISLANGNITVSIDGAK
YLIKEIEKFLNKSEV
MKATGVIRKVDELGRIVIPKELRDVLGIQIKSPLEIFVEEDKVILQKYQPYNACQITGDVSNQNISLANGNITVSIDGAK
YLIKEIEKFLNKSEV
Nucleotide
Download Length: 288 bp
>NTDB_id=33576 BCA_RS10995 WP_000648331.1 1934720..1935007(+) (abrB) [Bacillus cereus 03BB102]
ATGAAAGCAACAGGAGTTATTCGAAAAGTAGACGAATTAGGACGAATTGTTATTCCTAAAGAATTACGTGATGTATTGGG
AATACAAATCAAATCACCGCTTGAAATTTTCGTAGAAGAAGACAAAGTCATTTTACAAAAATATCAACCTTACAATGCTT
GTCAAATAACAGGTGATGTTTCAAATCAAAACATATCATTAGCAAATGGAAACATTACTGTTAGTATAGATGGAGCGAAA
TATTTAATAAAAGAAATAGAGAAGTTTTTAAACAAGAGTGAGGTTTAG
ATGAAAGCAACAGGAGTTATTCGAAAAGTAGACGAATTAGGACGAATTGTTATTCCTAAAGAATTACGTGATGTATTGGG
AATACAAATCAAATCACCGCTTGAAATTTTCGTAGAAGAAGACAAAGTCATTTTACAAAAATATCAACCTTACAATGCTT
GTCAAATAACAGGTGATGTTTCAAATCAAAACATATCATTAGCAAATGGAAACATTACTGTTAGTATAGATGGAGCGAAA
TATTTAATAAAAGAAATAGAGAAGTTTTTAAACAAGAGTGAGGTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.444 |
94.737 |
0.516 |