Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EQI87_RS12725 Genome accession   NZ_CP035166
Coordinates   2443497..2443871 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SRCM103971     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2438497..2448871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI87_RS12685 (EQI87_12685) yqhG 2438828..2439622 (+) 795 WP_003230200.1 YqhG family protein -
  EQI87_RS12690 (EQI87_12690) sinI 2439805..2439978 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI87_RS12695 (EQI87_12695) sinR 2440012..2440347 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI87_RS12700 (EQI87_12700) tasA 2440440..2441225 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQI87_RS12705 (EQI87_12705) sipW 2441289..2441861 (-) 573 WP_003230181.1 signal peptidase I SipW -
  EQI87_RS12710 (EQI87_12710) tapA 2441845..2442606 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  EQI87_RS12715 (EQI87_12715) yqzG 2442878..2443204 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI87_RS12720 (EQI87_12720) spoIITA 2443246..2443425 (-) 180 WP_029726723.1 YqzE family protein -
  EQI87_RS12725 (EQI87_12725) comGG 2443497..2443871 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQI87_RS12730 (EQI87_12730) comGF 2443872..2444255 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  EQI87_RS12735 (EQI87_12735) comGE 2444281..2444628 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  EQI87_RS12740 (EQI87_12740) comGD 2444612..2445043 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  EQI87_RS12745 (EQI87_12745) comGC 2445033..2445329 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  EQI87_RS12750 (EQI87_12750) comGB 2445343..2446380 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  EQI87_RS12755 (EQI87_12755) comGA 2446367..2447437 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQI87_RS12760 (EQI87_12760) - 2447649..2447846 (-) 198 WP_014480259.1 CBS domain-containing protein -
  EQI87_RS12765 (EQI87_12765) corA 2447848..2448801 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=335364 EQI87_RS12725 WP_014480253.1 2443497..2443871(-) (comGG) [Bacillus subtilis strain SRCM103971]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=335364 EQI87_RS12725 WP_014480253.1 2443497..2443871(-) (comGG) [Bacillus subtilis strain SRCM103971]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment