Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQI56_RS13055 Genome accession   NZ_CP035165
Coordinates   2508188..2508571 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103881     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2503188..2513571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI56_RS13015 (EQI56_13015) sinI 2504122..2504295 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI56_RS13020 (EQI56_13020) sinR 2504329..2504664 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI56_RS13025 (EQI56_13025) tasA 2504757..2505542 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  EQI56_RS13030 (EQI56_13030) sipW 2505606..2506178 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EQI56_RS13035 (EQI56_13035) tapA 2506162..2506923 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  EQI56_RS13040 (EQI56_13040) yqzG 2507195..2507521 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI56_RS13045 (EQI56_13045) spoIITA 2507563..2507742 (-) 180 WP_003230176.1 YqzE family protein -
  EQI56_RS13050 (EQI56_13050) comGG 2507813..2508187 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  EQI56_RS13055 (EQI56_13055) comGF 2508188..2508571 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  EQI56_RS13060 (EQI56_13060) comGE 2508597..2508944 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  EQI56_RS13065 (EQI56_13065) comGD 2508928..2509359 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  EQI56_RS13070 (EQI56_13070) comGC 2509349..2509645 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EQI56_RS13075 (EQI56_13075) comGB 2509659..2510696 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  EQI56_RS13080 (EQI56_13080) comGA 2510683..2511753 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQI56_RS13090 (EQI56_13090) corA 2512164..2513117 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=335281 EQI56_RS13055 WP_041850015.1 2508188..2508571(-) (comGF) [Bacillus subtilis strain SRCM103881]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=335281 EQI56_RS13055 WP_041850015.1 2508188..2508571(-) (comGF) [Bacillus subtilis strain SRCM103881]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment