Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQI56_RS13015 Genome accession   NZ_CP035165
Coordinates   2504122..2504295 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM103881     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2499122..2509295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI56_RS13000 (EQI56_13000) gcvT 2499922..2501010 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  EQI56_RS13005 (EQI56_13005) hepAA 2501451..2503124 (+) 1674 WP_041850014.1 SNF2-related protein -
  EQI56_RS13010 (EQI56_13010) yqhG 2503145..2503939 (+) 795 WP_003230200.1 YqhG family protein -
  EQI56_RS13015 (EQI56_13015) sinI 2504122..2504295 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI56_RS13020 (EQI56_13020) sinR 2504329..2504664 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI56_RS13025 (EQI56_13025) tasA 2504757..2505542 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  EQI56_RS13030 (EQI56_13030) sipW 2505606..2506178 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EQI56_RS13035 (EQI56_13035) tapA 2506162..2506923 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  EQI56_RS13040 (EQI56_13040) yqzG 2507195..2507521 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI56_RS13045 (EQI56_13045) spoIITA 2507563..2507742 (-) 180 WP_003230176.1 YqzE family protein -
  EQI56_RS13050 (EQI56_13050) comGG 2507813..2508187 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  EQI56_RS13055 (EQI56_13055) comGF 2508188..2508571 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  EQI56_RS13060 (EQI56_13060) comGE 2508597..2508944 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=335278 EQI56_RS13015 WP_003230187.1 2504122..2504295(+) (sinI) [Bacillus subtilis strain SRCM103881]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=335278 EQI56_RS13015 WP_003230187.1 2504122..2504295(+) (sinI) [Bacillus subtilis strain SRCM103881]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment