Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EQH88_RS16705 Genome accession   NZ_CP035161
Coordinates   3171992..3172132 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103862     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3166992..3177132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQH88_RS16680 (EQH88_16680) yuxO 3167268..3167648 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  EQH88_RS16685 (EQH88_16685) comA 3167667..3168311 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EQH88_RS16690 (EQH88_16690) comP 3168392..3170704 (-) 2313 WP_069703660.1 histidine kinase Regulator
  EQH88_RS16695 (EQH88_16695) comX 3170720..3170941 (-) 222 WP_014480704.1 competence pheromone ComX -
  EQH88_RS16700 (EQH88_16700) - 3170943..3171806 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  EQH88_RS16705 (EQH88_16705) degQ 3171992..3172132 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EQH88_RS21925 - 3172354..3172416 (+) 63 Protein_3220 hypothetical protein -
  EQH88_RS16710 (EQH88_16710) - 3172594..3172962 (+) 369 WP_017695529.1 hypothetical protein -
  EQH88_RS16715 (EQH88_16715) pdeH 3172938..3174167 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  EQH88_RS16720 (EQH88_16720) pncB 3174304..3175776 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EQH88_RS16725 (EQH88_16725) pncA 3175792..3176343 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  EQH88_RS16730 (EQH88_16730) yueI 3176440..3176838 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=334984 EQH88_RS16705 WP_003220708.1 3171992..3172132(-) (degQ) [Bacillus subtilis strain SRCM103862]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=334984 EQH88_RS16705 WP_003220708.1 3171992..3172132(-) (degQ) [Bacillus subtilis strain SRCM103862]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment