Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EJ992_RS13305 Genome accession   NZ_CP034569
Coordinates   2566584..2566760 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain ATCC 14580     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2561584..2571760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJ992_RS13290 (EJ992_13290) gcvT 2562226..2563320 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  EJ992_RS13295 (EJ992_13295) - 2563913..2565592 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  EJ992_RS13300 (EJ992_13300) - 2565599..2566393 (+) 795 WP_003183441.1 YqhG family protein -
  EJ992_RS13305 (EJ992_13305) sinI 2566584..2566760 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  EJ992_RS13310 (EJ992_13310) sinR 2566794..2567129 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  EJ992_RS13315 (EJ992_13315) tasA 2567234..2568028 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  EJ992_RS13320 (EJ992_13320) sipW 2568102..2568686 (-) 585 WP_003183449.1 signal peptidase I SipW -
  EJ992_RS13325 (EJ992_13325) tapA 2568683..2569411 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  EJ992_RS13330 (EJ992_13330) - 2569688..2570008 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  EJ992_RS13335 (EJ992_13335) - 2570038..2570220 (-) 183 WP_003183456.1 YqzE family protein -
  EJ992_RS13340 (EJ992_13340) comGG 2570309..2570674 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  EJ992_RS13345 (EJ992_13345) comGF 2570687..2571175 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  EJ992_RS13350 (EJ992_13350) comGE 2571084..2571431 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=331997 EJ992_RS13305 WP_003183444.1 2566584..2566760(+) (sinI) [Bacillus licheniformis strain ATCC 14580]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=331997 EJ992_RS13305 WP_003183444.1 2566584..2566760(+) (sinI) [Bacillus licheniformis strain ATCC 14580]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment