Detailed information
Bioinformatically predicted
Overview
| Name | comX | Type | Regulator |
| Locus tag | EJJ34_RS17355 | Genome accession | NZ_CP034484 |
| Coordinates | 3251082..3251249 (-) | Length | 55 a.a. |
| NCBI ID | WP_003242801.1 | Uniprot ID | G9LQ80 |
| Organism | Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610 | ||
| Function | binding to ComP; trigger autophosphorylation of ComP (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3246082..3256249
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJJ34_RS17325 (EJJ34_17330) | mrpE | 3246477..3246953 (+) | 477 | WP_003244015.1 | Na+/H+ antiporter subunit E | - |
| EJJ34_RS17330 (EJJ34_17335) | mrpF | 3246953..3247237 (+) | 285 | WP_003228814.1 | Na(+)/H(+) antiporter subunit F1 | - |
| EJJ34_RS17335 (EJJ34_17340) | mnhG | 3247221..3247595 (+) | 375 | WP_003244302.1 | monovalent cation/H(+) antiporter subunit G | - |
| EJJ34_RS17340 (EJJ34_17345) | yuxO | 3247634..3248014 (-) | 381 | WP_003228810.1 | hotdog fold thioesterase | - |
| EJJ34_RS17345 (EJJ34_17350) | comA | 3248033..3248677 (-) | 645 | WP_003220716.1 | two-component system response regulator ComA | Regulator |
| EJJ34_RS17350 (EJJ34_17355) | comP | 3248758..3251067 (-) | 2310 | WP_003242894.1 | two-component system sensor histidine kinase ComP | Regulator |
| EJJ34_RS17355 (EJJ34_17360) | comX | 3251082..3251249 (-) | 168 | WP_003242801.1 | competence pheromone ComX | Regulator |
| EJJ34_RS17360 (EJJ34_17365) | comQ | 3251237..3252136 (-) | 900 | WP_003243039.1 | ComX modifying isoprenyl transferase ComQ | Regulator |
| EJJ34_RS17365 (EJJ34_17370) | degQ | 3252321..3252461 (-) | 141 | WP_003220708.1 | degradation enzyme regulation protein DegQ | Regulator |
| EJJ34_RS17370 (EJJ34_17375) | - | 3252683..3252808 (+) | 126 | WP_003228793.1 | hypothetical protein | - |
| EJJ34_RS17375 (EJJ34_17380) | - | 3252922..3253290 (+) | 369 | WP_003243784.1 | hypothetical protein | - |
| EJJ34_RS17380 (EJJ34_17385) | pdeH | 3253266..3254487 (-) | 1222 | Protein_3333 | cyclic di-GMP phosphodiesterase | - |
| EJJ34_RS17385 (EJJ34_17390) | pncB | 3254624..3256096 (-) | 1473 | WP_003228788.1 | nicotinate phosphoribosyltransferase | - |
Sequence
Protein
Download Length: 55 a.a. Molecular weight: 6518.42 Da Isoelectric Point: 4.3285
>NTDB_id=331685 EJJ34_RS17355 WP_003242801.1 3251082..3251249(-) (comX) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD
Nucleotide
Download Length: 168 bp
>NTDB_id=331685 EJJ34_RS17355 WP_003242801.1 3251082..3251249(-) (comX) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comX | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |