Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   EJJ34_RS13480 Genome accession   NZ_CP034484
Coordinates   2552147..2552494 (-) Length   115 a.a.
NCBI ID   WP_003230165.1    Uniprot ID   A0AAE2SKU3
Organism   Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2547147..2557494
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJJ34_RS13435 (EJJ34_13440) sinI 2547672..2547845 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EJJ34_RS13440 (EJJ34_13445) sinR 2547879..2548214 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EJJ34_RS13445 (EJJ34_13450) tasA 2548307..2549092 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  EJJ34_RS13450 (EJJ34_13455) sipW 2549156..2549728 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EJJ34_RS13455 (EJJ34_13460) tapA 2549712..2550473 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  EJJ34_RS13460 (EJJ34_13465) yqzG 2550745..2551071 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EJJ34_RS13465 (EJJ34_13470) spoIITA 2551113..2551292 (-) 180 WP_003230176.1 YqzE family protein -
  EJJ34_RS13470 (EJJ34_13475) comGG 2551363..2551737 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  EJJ34_RS13475 (EJJ34_13480) comGF 2551738..2552121 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  EJJ34_RS13480 (EJJ34_13485) comGE 2552147..2552494 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  EJJ34_RS13485 (EJJ34_13490) comGD 2552478..2552909 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  EJJ34_RS13490 (EJJ34_13495) comGC 2552899..2553195 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  EJJ34_RS13495 (EJJ34_13500) comGB 2553209..2554246 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  EJJ34_RS13500 (EJJ34_13505) comGA 2554233..2555303 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EJJ34_RS13510 (EJJ34_13515) corA 2555715..2556668 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13271.33 Da        Isoelectric Point: 5.1901

>NTDB_id=331665 EJJ34_RS13480 WP_003230165.1 2552147..2552494(-) (comGE) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAASKTITKNNHIYAMK
WEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=331665 EJJ34_RS13480 WP_003230165.1 2552147..2552494(-) (comGE) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTGTGCTGCTGACAGT
CGTCCCCTTGTGGGACAAGCTGATGGCTGATGAAAAAATGGCGGAATCACGAGAAATTGGCTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGAGTGGTGAAGGAGCCGCGTCAAAAACGATTACAAAGAACAATCATATCTATGCAATGAAG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGTATCAAAGCCGCAGCTTATAAAGAAAAATCATTTTGCCTCAGCATTTT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment