Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EJJ34_RS13435 | Genome accession | NZ_CP034484 |
| Coordinates | 2547672..2547845 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2542672..2552845
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJJ34_RS13420 (EJJ34_13425) | gcvT | 2543471..2544559 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EJJ34_RS13425 (EJJ34_13430) | hepAA | 2545001..2546674 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| EJJ34_RS13430 (EJJ34_13435) | yqhG | 2546695..2547489 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| EJJ34_RS13435 (EJJ34_13440) | sinI | 2547672..2547845 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| EJJ34_RS13440 (EJJ34_13445) | sinR | 2547879..2548214 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| EJJ34_RS13445 (EJJ34_13450) | tasA | 2548307..2549092 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| EJJ34_RS13450 (EJJ34_13455) | sipW | 2549156..2549728 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| EJJ34_RS13455 (EJJ34_13460) | tapA | 2549712..2550473 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EJJ34_RS13460 (EJJ34_13465) | yqzG | 2550745..2551071 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| EJJ34_RS13465 (EJJ34_13470) | spoIITA | 2551113..2551292 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| EJJ34_RS13470 (EJJ34_13475) | comGG | 2551363..2551737 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| EJJ34_RS13475 (EJJ34_13480) | comGF | 2551738..2552121 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| EJJ34_RS13480 (EJJ34_13485) | comGE | 2552147..2552494 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=331661 EJJ34_RS13435 WP_003230187.1 2547672..2547845(+) (sinI) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=331661 EJJ34_RS13435 WP_003230187.1 2547672..2547845(+) (sinI) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |