Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   FQB22_RS21345 Genome accession   NZ_CP042252
Coordinates   4131680..4132117 (-) Length   145 a.a.
NCBI ID   WP_009327905.1    Uniprot ID   Q8VQ70
Organism   Bacillus licheniformis strain KNU11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 4126680..4137117
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQB22_RS21295 sinI 4126855..4127031 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  FQB22_RS21300 sinR 4127065..4127400 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  FQB22_RS21305 tasA 4127505..4128299 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  FQB22_RS21310 sipW 4128373..4128957 (-) 585 WP_003183449.1 signal peptidase I SipW -
  FQB22_RS21315 tapA 4128954..4129682 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  FQB22_RS21320 - 4129959..4130279 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  FQB22_RS21325 - 4130303..4130485 (-) 183 WP_003183456.1 YqzE family protein -
  FQB22_RS21330 comGG 4130574..4130939 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  FQB22_RS21335 comGF 4130952..4131440 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  FQB22_RS21340 comGE 4131349..4131696 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  FQB22_RS21345 comGD 4131680..4132117 (-) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  FQB22_RS21350 comGC 4132123..4132416 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  FQB22_RS21355 comGB 4132430..4133464 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  FQB22_RS21360 comGA 4133454..4134518 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  FQB22_RS21365 - 4134675..4135514 (-) 840 WP_003183480.1 STAS domain-containing protein -
  FQB22_RS21375 - 4135756..4136133 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  FQB22_RS21380 - 4136342..4136587 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16249.07 Da        Isoelectric Point: 9.6739

>NTDB_id=330771 FQB22_RS21345 WP_009327905.1 4131680..4132117(-) (comGD) [Bacillus licheniformis strain KNU11]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=330771 FQB22_RS21345 WP_009327905.1 4131680..4132117(-) (comGD) [Bacillus licheniformis strain KNU11]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8VQ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393