Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FQB22_RS21295 Genome accession   NZ_CP042252
Coordinates   4126855..4127031 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   Q65HF5
Organism   Bacillus licheniformis strain KNU11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 4121855..4132031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FQB22_RS21280 gcvT 4122497..4123591 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  FQB22_RS21285 - 4124184..4125863 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  FQB22_RS21290 - 4125870..4126664 (+) 795 WP_003183441.1 YqhG family protein -
  FQB22_RS21295 sinI 4126855..4127031 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  FQB22_RS21300 sinR 4127065..4127400 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  FQB22_RS21305 tasA 4127505..4128299 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  FQB22_RS21310 sipW 4128373..4128957 (-) 585 WP_003183449.1 signal peptidase I SipW -
  FQB22_RS21315 tapA 4128954..4129682 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  FQB22_RS21320 - 4129959..4130279 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  FQB22_RS21325 - 4130303..4130485 (-) 183 WP_003183456.1 YqzE family protein -
  FQB22_RS21330 comGG 4130574..4130939 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  FQB22_RS21335 comGF 4130952..4131440 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  FQB22_RS21340 comGE 4131349..4131696 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=330769 FQB22_RS21295 WP_003183444.1 4126855..4127031(+) (sinI) [Bacillus licheniformis strain KNU11]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=330769 FQB22_RS21295 WP_003183444.1 4126855..4127031(+) (sinI) [Bacillus licheniformis strain KNU11]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q65HF5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517