Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BVMH_RS12540 Genome accession   NZ_CP034176
Coordinates   2565975..2566352 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain MH25     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2560975..2571352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVMH_RS12500 (BVMH_12500) - 2561473..2562267 (+) 795 WP_076424968.1 YqhG family protein -
  BVMH_RS12505 (BVMH_12505) sinI 2562444..2562617 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BVMH_RS12510 (BVMH_12510) sinR 2562651..2562986 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVMH_RS12515 (BVMH_12515) - 2563034..2563819 (-) 786 WP_007408329.1 TasA family protein -
  BVMH_RS12520 (BVMH_12520) - 2563884..2564468 (-) 585 WP_015240205.1 signal peptidase I -
  BVMH_RS12525 (BVMH_12525) tapA 2564440..2565111 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  BVMH_RS12530 (BVMH_12530) - 2565370..2565699 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BVMH_RS12535 (BVMH_12535) - 2565739..2565918 (-) 180 WP_003153093.1 YqzE family protein -
  BVMH_RS12540 (BVMH_12540) comGG 2565975..2566352 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVMH_RS12545 (BVMH_12545) comGF 2566353..2566853 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  BVMH_RS12550 (BVMH_12550) comGE 2566762..2567076 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BVMH_RS12555 (BVMH_12555) comGD 2567060..2567497 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVMH_RS12560 (BVMH_12560) comGC 2567487..2567795 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BVMH_RS12565 (BVMH_12565) comGB 2567800..2568837 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVMH_RS12570 (BVMH_12570) comGA 2568824..2569894 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BVMH_RS12575 (BVMH_12575) - 2570088..2571038 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=329629 BVMH_RS12540 WP_012117980.1 2565975..2566352(-) (comGG) [Bacillus velezensis strain MH25]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=329629 BVMH_RS12540 WP_012117980.1 2565975..2566352(-) (comGG) [Bacillus velezensis strain MH25]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment