Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVMH_RS12505 | Genome accession | NZ_CP034176 |
| Coordinates | 2562444..2562617 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain MH25 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2557444..2567617
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVMH_RS12490 (BVMH_12490) | gcvT | 2558257..2559357 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVMH_RS12495 (BVMH_12495) | - | 2559781..2561451 (+) | 1671 | WP_124934996.1 | SNF2-related protein | - |
| BVMH_RS12500 (BVMH_12500) | - | 2561473..2562267 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| BVMH_RS12505 (BVMH_12505) | sinI | 2562444..2562617 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| BVMH_RS12510 (BVMH_12510) | sinR | 2562651..2562986 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVMH_RS12515 (BVMH_12515) | - | 2563034..2563819 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| BVMH_RS12520 (BVMH_12520) | - | 2563884..2564468 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| BVMH_RS12525 (BVMH_12525) | tapA | 2564440..2565111 (-) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVMH_RS12530 (BVMH_12530) | - | 2565370..2565699 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BVMH_RS12535 (BVMH_12535) | - | 2565739..2565918 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVMH_RS12540 (BVMH_12540) | comGG | 2565975..2566352 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVMH_RS12545 (BVMH_12545) | comGF | 2566353..2566853 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| BVMH_RS12550 (BVMH_12550) | comGE | 2566762..2567076 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| BVMH_RS12555 (BVMH_12555) | comGD | 2567060..2567497 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=329627 BVMH_RS12505 WP_003153105.1 2562444..2562617(+) (sinI) [Bacillus velezensis strain MH25]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=329627 BVMH_RS12505 WP_003153105.1 2562444..2562617(+) (sinI) [Bacillus velezensis strain MH25]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |