Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BVMH_RS12505 Genome accession   NZ_CP034176
Coordinates   2562444..2562617 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain MH25     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2557444..2567617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVMH_RS12490 (BVMH_12490) gcvT 2558257..2559357 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  BVMH_RS12495 (BVMH_12495) - 2559781..2561451 (+) 1671 WP_124934996.1 SNF2-related protein -
  BVMH_RS12500 (BVMH_12500) - 2561473..2562267 (+) 795 WP_076424968.1 YqhG family protein -
  BVMH_RS12505 (BVMH_12505) sinI 2562444..2562617 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BVMH_RS12510 (BVMH_12510) sinR 2562651..2562986 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVMH_RS12515 (BVMH_12515) - 2563034..2563819 (-) 786 WP_007408329.1 TasA family protein -
  BVMH_RS12520 (BVMH_12520) - 2563884..2564468 (-) 585 WP_015240205.1 signal peptidase I -
  BVMH_RS12525 (BVMH_12525) tapA 2564440..2565111 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  BVMH_RS12530 (BVMH_12530) - 2565370..2565699 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BVMH_RS12535 (BVMH_12535) - 2565739..2565918 (-) 180 WP_003153093.1 YqzE family protein -
  BVMH_RS12540 (BVMH_12540) comGG 2565975..2566352 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVMH_RS12545 (BVMH_12545) comGF 2566353..2566853 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  BVMH_RS12550 (BVMH_12550) comGE 2566762..2567076 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BVMH_RS12555 (BVMH_12555) comGD 2567060..2567497 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=329627 BVMH_RS12505 WP_003153105.1 2562444..2562617(+) (sinI) [Bacillus velezensis strain MH25]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=329627 BVMH_RS12505 WP_003153105.1 2562444..2562617(+) (sinI) [Bacillus velezensis strain MH25]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment