Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   EG219_RS14015 Genome accession   NZ_CP034037
Coordinates   2836822..2836962 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BCSo1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2831822..2841962
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG219_RS13985 (EG219_13985) - 2832481..2832957 (+) 477 WP_007408672.1 Na+/H+ antiporter subunit E -
  EG219_RS13990 (EG219_13990) - 2832957..2833241 (+) 285 WP_007408673.1 Na(+)/H(+) antiporter subunit F1 -
  EG219_RS13995 (EG219_13995) mnhG 2833225..2833599 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  EG219_RS14000 (EG219_14000) - 2833639..2834022 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  EG219_RS14005 (EG219_14005) comA 2834044..2834688 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  EG219_RS14010 (EG219_14010) - 2834769..2836528 (-) 1760 Protein_2695 sensor histidine kinase -
  EG219_RS18800 - 2836410..2836691 (-) 282 WP_240631631.1 hypothetical protein -
  EG219_RS14015 (EG219_14015) degQ 2836822..2836962 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  EG219_RS14025 (EG219_14025) - 2837428..2837769 (+) 342 WP_007408677.1 hypothetical protein -
  EG219_RS14030 (EG219_14030) - 2837776..2838999 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  EG219_RS14035 (EG219_14035) - 2839129..2840595 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  EG219_RS14040 (EG219_14040) - 2840613..2841164 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  EG219_RS14045 (EG219_14045) - 2841261..2841659 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=328562 EG219_RS14015 WP_003152043.1 2836822..2836962(-) (degQ) [Bacillus velezensis strain BCSo1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=328562 EG219_RS14015 WP_003152043.1 2836822..2836962(-) (degQ) [Bacillus velezensis strain BCSo1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment