Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   EGH16_RS02745 Genome accession   NZ_CP034032
Coordinates   454031..454504 (+) Length   157 a.a.
NCBI ID   WP_195764428.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FQ01     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 455050..494476 454031..454504 flank 546


Gene organization within MGE regions


Location: 454031..494476
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGH16_RS02745 (EGH16_02745) pilL 454031..454504 (+) 474 WP_195764428.1 PilX family type IV pilin Machinery gene
  EGH16_RS02760 (EGH16_02760) - 455116..455561 (-) 446 Protein_459 AzlC family ABC transporter permease -
  EGH16_RS02765 (EGH16_02765) dut 455727..456179 (+) 453 WP_003690909.1 dUTP diphosphatase -
  EGH16_RS02770 (EGH16_02770) dapC 456257..457444 (+) 1188 WP_047949582.1 succinyldiaminopimelate transaminase -
  EGH16_RS02775 (EGH16_02775) yaaA 457709..458488 (+) 780 WP_047949581.1 peroxide stress protein YaaA -
  EGH16_RS02790 (EGH16_02790) - 459019..460218 (+) 1200 Protein_463 integrase arm-type DNA-binding domain-containing protein -
  EGH16_RS02800 (EGH16_02800) - 460574..460843 (-) 270 WP_003687928.1 hypothetical protein -
  EGH16_RS02805 (EGH16_02805) - 461038..461721 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  EGH16_RS14755 - 462035..462268 (-) 234 Protein_466 hypothetical protein -
  EGH16_RS02815 (EGH16_02815) - 462379..462594 (-) 216 WP_003691538.1 hypothetical protein -
  EGH16_RS02820 (EGH16_02820) - 462646..463137 (-) 492 WP_004464807.1 siphovirus Gp157 family protein -
  EGH16_RS02825 (EGH16_02825) - 463134..463316 (-) 183 WP_003691535.1 hypothetical protein -
  EGH16_RS02830 (EGH16_02830) - 463456..464142 (-) 687 WP_010357532.1 hypothetical protein -
  EGH16_RS02835 (EGH16_02835) - 464211..464372 (-) 162 WP_047924242.1 hypothetical protein -
  EGH16_RS02840 (EGH16_02840) - 464369..464644 (-) 276 WP_003705605.1 hypothetical protein -
  EGH16_RS02845 (EGH16_02845) - 464797..465129 (-) 333 WP_003695500.1 hypothetical protein -
  EGH16_RS02850 (EGH16_02850) - 465268..465537 (-) 270 WP_124743185.1 hypothetical protein -
  EGH16_RS02855 (EGH16_02855) - 465534..466010 (-) 477 WP_002255718.1 hypothetical protein -
  EGH16_RS02860 (EGH16_02860) - 466043..466243 (-) 201 WP_003704298.1 hypothetical protein -
  EGH16_RS02865 (EGH16_02865) - 466441..466854 (-) 414 WP_003687963.1 hypothetical protein -
  EGH16_RS02870 (EGH16_02870) - 466851..467312 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  EGH16_RS02875 (EGH16_02875) - 467329..467766 (-) 438 WP_003687967.1 hypothetical protein -
  EGH16_RS02880 (EGH16_02880) - 467879..468595 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  EGH16_RS02885 (EGH16_02885) - 468664..468900 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  EGH16_RS02890 (EGH16_02890) - 468980..469135 (+) 156 WP_003698902.1 hypothetical protein -
  EGH16_RS02895 (EGH16_02895) - 469112..469300 (-) 189 WP_003691445.1 hypothetical protein -
  EGH16_RS02900 (EGH16_02900) - 469473..469700 (+) 228 WP_003693879.1 helix-turn-helix domain-containing protein -
  EGH16_RS14180 - 470379..470882 (+) 504 WP_010360005.1 hypothetical protein -
  EGH16_RS02910 (EGH16_02910) - 470879..472240 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  EGH16_RS02915 (EGH16_02915) - 472257..472487 (+) 231 WP_012503490.1 hypothetical protein -
  EGH16_RS02920 (EGH16_02920) - 472578..473072 (+) 495 WP_082298905.1 DUF3310 domain-containing protein -
  EGH16_RS02925 (EGH16_02925) - 473249..473398 (+) 150 WP_003692854.1 hypothetical protein -
  EGH16_RS14185 - 473427..473708 (+) 282 WP_003689109.1 hypothetical protein -
  EGH16_RS02930 (EGH16_02930) - 473699..474136 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  EGH16_RS02935 (EGH16_02935) - 474129..474434 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  EGH16_RS02940 (EGH16_02940) - 474431..474814 (+) 384 WP_003690918.1 recombination protein NinB -
  EGH16_RS02945 (EGH16_02945) - 474805..475322 (+) 518 Protein_494 HNH endonuclease signature motif containing protein -
  EGH16_RS02950 (EGH16_02950) - 475387..475809 (+) 423 WP_003690919.1 hypothetical protein -
  EGH16_RS14190 - 475809..476348 (+) 540 WP_003690920.1 hypothetical protein -
  EGH16_RS02965 (EGH16_02965) - 476329..477603 (+) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  EGH16_RS02970 (EGH16_02970) - 477588..479855 (+) 2268 WP_229684483.1 hypothetical protein -
  EGH16_RS02975 (EGH16_02975) - 480185..481063 (+) 879 WP_124743186.1 KilA-N domain-containing protein -
  EGH16_RS02980 (EGH16_02980) - 481308..482504 (+) 1197 WP_047949756.1 hypothetical protein -
  EGH16_RS02990 (EGH16_02990) - 482501..489831 (+) 7331 Protein_501 PLxRFG domain-containing protein -
  EGH16_RS03000 (EGH16_03000) - 490457..491752 (+) 1296 WP_003695011.1 DUF4043 family protein -
  EGH16_RS03005 (EGH16_03005) - 491807..492280 (+) 474 WP_003687996.1 hypothetical protein -
  EGH16_RS03010 (EGH16_03010) - 492286..492771 (+) 486 WP_003687997.1 hypothetical protein -
  EGH16_RS03015 (EGH16_03015) - 492768..493442 (+) 675 WP_003687998.1 hypothetical protein -
  EGH16_RS03020 (EGH16_03020) - 493445..493594 (+) 150 WP_047949669.1 hypothetical protein -
  EGH16_RS03025 (EGH16_03025) - 493631..494476 (-) 846 WP_124743187.1 Bro-N domain-containing protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17534.43 Da        Isoelectric Point: 9.8238

>NTDB_id=328430 EGH16_RS02745 WP_195764428.1 454031..454504(+) (pilL) [Neisseria gonorrhoeae strain FQ01]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKVYKEQLSGDGGCEALSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=328430 EGH16_RS02745 WP_195764428.1 454031..454504(+) (pilL) [Neisseria gonorrhoeae strain FQ01]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGTCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

89.809

100

0.898
  pilX Neisseria meningitidis 8013

85.35

100

0.854

Multiple sequence alignment