Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | EGH20_RS02765 | Genome accession | NZ_CP034026 |
| Coordinates | 453285..453758 (+) | Length | 157 a.a. |
| NCBI ID | WP_170959666.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain FQ20 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 454392..505883 | 453285..453758 | flank | 634 |
Gene organization within MGE regions
Location: 453285..505883
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGH20_RS02765 (EGH20_02765) | pilL | 453285..453758 (+) | 474 | WP_170959666.1 | PilX family type IV pilin | Machinery gene |
| EGH20_RS02770 (EGH20_02770) | - | 453828..454136 (-) | 309 | WP_047920338.1 | AzlD family protein | - |
| EGH20_RS13380 | - | 454133..454843 (-) | 711 | Protein_457 | AzlC family ABC transporter permease | - |
| EGH20_RS02780 (EGH20_02780) | dut | 455009..455461 (+) | 453 | WP_010359930.1 | dUTP diphosphatase | - |
| EGH20_RS02785 (EGH20_02785) | dapC | 455539..456726 (+) | 1188 | WP_123776160.1 | succinyldiaminopimelate transaminase | - |
| EGH20_RS02790 (EGH20_02790) | yaaA | 457037..457816 (+) | 780 | WP_124723909.1 | peroxide stress protein YaaA | - |
| EGH20_RS02805 (EGH20_02805) | - | 458347..459540 (+) | 1194 | WP_010359935.1 | integrase arm-type DNA-binding domain-containing protein | - |
| EGH20_RS02815 (EGH20_02815) | - | 459896..460165 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| EGH20_RS02820 (EGH20_02820) | - | 460360..461043 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| EGH20_RS14600 | - | 461357..461590 (-) | 234 | Protein_464 | hypothetical protein | - |
| EGH20_RS02830 (EGH20_02830) | - | 461701..461916 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| EGH20_RS02835 (EGH20_02835) | - | 461968..462459 (-) | 492 | WP_003696912.1 | siphovirus Gp157 family protein | - |
| EGH20_RS02840 (EGH20_02840) | - | 462456..462638 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| EGH20_RS02845 (EGH20_02845) | - | 462778..463464 (-) | 687 | WP_042758540.1 | hypothetical protein | - |
| EGH20_RS02850 (EGH20_02850) | - | 463533..463694 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| EGH20_RS02855 (EGH20_02855) | - | 463691..463966 (-) | 276 | WP_047918704.1 | hypothetical protein | - |
| EGH20_RS02860 (EGH20_02860) | - | 464119..464451 (-) | 333 | WP_010357536.1 | hypothetical protein | - |
| EGH20_RS02865 (EGH20_02865) | - | 464593..464880 (-) | 288 | WP_124723910.1 | hypothetical protein | - |
| EGH20_RS02870 (EGH20_02870) | - | 464877..465353 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| EGH20_RS02875 (EGH20_02875) | - | 465386..465586 (-) | 201 | WP_048654497.1 | hypothetical protein | - |
| EGH20_RS02880 (EGH20_02880) | - | 466070..466288 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| EGH20_RS02885 (EGH20_02885) | - | 466305..466664 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| EGH20_RS02890 (EGH20_02890) | - | 466665..467204 (-) | 540 | WP_003695998.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| EGH20_RS02895 (EGH20_02895) | - | 467364..468080 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| EGH20_RS02905 (EGH20_02905) | - | 468461..468688 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| EGH20_RS02910 (EGH20_02910) | - | 468806..469870 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| EGH20_RS02915 (EGH20_02915) | - | 469867..471228 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| EGH20_RS02920 (EGH20_02920) | - | 471245..471475 (+) | 231 | WP_033909710.1 | hypothetical protein | - |
| EGH20_RS02925 (EGH20_02925) | - | 471566..472060 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| EGH20_RS02935 (EGH20_02935) | - | 472391..472540 (+) | 150 | WP_003692854.1 | hypothetical protein | - |
| EGH20_RS14055 | - | 472569..472850 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| EGH20_RS02940 (EGH20_02940) | - | 472841..473221 (+) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EGH20_RS02950 (EGH20_02950) | - | 473488..473895 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| EGH20_RS02955 (EGH20_02955) | - | 473986..475146 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| EGH20_RS02960 (EGH20_02960) | - | 475644..476531 (+) | 888 | WP_124723911.1 | KilA-N domain-containing protein | - |
| EGH20_RS02965 (EGH20_02965) | - | 476824..477273 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| EGH20_RS02970 (EGH20_02970) | terL | 477335..478756 (+) | 1422 | WP_003689090.1 | phage terminase large subunit | - |
| EGH20_RS02975 (EGH20_02975) | - | 478753..480900 (+) | 2148 | WP_050159332.1 | phage portal protein | - |
| EGH20_RS02980 (EGH20_02980) | - | 480968..482125 (+) | 1158 | WP_047919766.1 | HK97 family phage prohead protease | - |
| EGH20_RS02985 (EGH20_02985) | - | 482166..483665 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| EGH20_RS02990 (EGH20_02990) | - | 483672..484004 (+) | 333 | WP_047919765.1 | hypothetical protein | - |
| EGH20_RS02995 (EGH20_02995) | - | 484007..484537 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| EGH20_RS03000 (EGH20_03000) | - | 484537..485019 (+) | 483 | WP_003703855.1 | HK97 gp10 family phage protein | - |
| EGH20_RS03005 (EGH20_03005) | - | 485016..485444 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| EGH20_RS03010 (EGH20_03010) | - | 485470..486243 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| EGH20_RS03015 (EGH20_03015) | - | 486304..486633 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| EGH20_RS03020 (EGH20_03020) | - | 486645..486911 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| EGH20_RS03025 (EGH20_03025) | - | 486911..487510 (+) | 600 | WP_003691415.1 | DUF2460 domain-containing protein | - |
| EGH20_RS03030 (EGH20_03030) | - | 487507..488361 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| EGH20_RS03035 (EGH20_03035) | - | 488363..488794 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| EGH20_RS03040 (EGH20_03040) | - | 488822..489100 (-) | 279 | WP_003692877.1 | XRE family transcriptional regulator | - |
| EGH20_RS03045 (EGH20_03045) | - | 489340..493485 (+) | 4146 | WP_124723912.1 | phage tail protein | - |
| EGH20_RS03050 (EGH20_03050) | - | 493597..493902 (+) | 306 | WP_047917725.1 | hypothetical protein | - |
| EGH20_RS03055 (EGH20_03055) | - | 493973..494443 (+) | 471 | WP_003689057.1 | hypothetical protein | - |
| EGH20_RS03060 (EGH20_03060) | - | 494444..494776 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| EGH20_RS03065 (EGH20_03065) | - | 495130..495477 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| EGH20_RS03070 (EGH20_03070) | - | 495477..495713 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| EGH20_RS03080 (EGH20_03080) | - | 495920..496459 (+) | 540 | WP_050169697.1 | TIGR02594 family protein | - |
| EGH20_RS13385 | - | 496459..496617 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| EGH20_RS03085 (EGH20_03085) | - | 496601..496942 (+) | 342 | WP_003700102.1 | hypothetical protein | - |
| EGH20_RS13390 | - | 496926..497099 (+) | 174 | WP_017146757.1 | hypothetical protein | - |
| EGH20_RS03090 (EGH20_03090) | - | 497413..497562 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| EGH20_RS03095 (EGH20_03095) | - | 497592..500639 (+) | 3048 | WP_050388721.1 | tape measure protein | - |
| EGH20_RS03100 (EGH20_03100) | - | 500699..501178 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| EGH20_RS03110 (EGH20_03110) | - | 501517..502506 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| EGH20_RS03115 (EGH20_03115) | - | 502766..502954 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| EGH20_RS03120 (EGH20_03120) | purM | 503195..504229 (+) | 1035 | WP_047923885.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| EGH20_RS03130 (EGH20_03130) | - | 505230..505883 (+) | 654 | WP_165865020.1 | IS1595-like element IS1016 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17412.10 Da Isoelectric Point: 9.3990
>NTDB_id=328282 EGH20_RS02765 WP_170959666.1 453285..453758(+) (pilL) [Neisseria gonorrhoeae strain FQ20]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLGIFVSGYKM
NPKIAKKYSVSVMFVDKEKSRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQAYSDTLSADSGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLGIFVSGYKM
NPKIAKKYSVSVMFVDKEKSRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQAYSDTLSADSGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=328282 EGH20_RS02765 WP_170959666.1 453285..453758(+) (pilL) [Neisseria gonorrhoeae strain FQ20]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGGAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAATGTTTGTCGATAAGGAAAAATCAAGGGCATACAGGTTGGTCGG
CGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGCCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGGAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAATGTTTGTCGATAAGGAAAAATCAAGGGCATACAGGTTGGTCGG
CGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGCCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
93.631 |
100 |
0.936 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |