Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | FGF55_RS15420 | Genome accession | NZ_CP041691 |
| Coordinates | 3101362..3101502 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain ZJU1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3096362..3106502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGF55_RS15395 (FGF55_15395) | - | 3096676..3097059 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| FGF55_RS15400 (FGF55_15400) | comA | 3097081..3097725 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| FGF55_RS15405 (FGF55_15405) | comP | 3097806..3100157 (-) | 2352 | WP_269800792.1 | histidine kinase | Regulator |
| FGF55_RS15410 (FGF55_15410) | comX | 3100135..3100305 (-) | 171 | WP_032863917.1 | competence pheromone ComX | - |
| FGF55_RS15415 (FGF55_15415) | comQ | 3100305..3101231 (-) | 927 | WP_014721741.1 | polyprenyl synthetase family protein | Regulator |
| FGF55_RS15420 (FGF55_15420) | degQ | 3101362..3101502 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| FGF55_RS15430 (FGF55_15430) | - | 3101968..3102309 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| FGF55_RS15435 (FGF55_15435) | - | 3102316..3103539 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| FGF55_RS15440 (FGF55_15440) | - | 3103669..3105135 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| FGF55_RS15445 (FGF55_15445) | - | 3105153..3105704 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| FGF55_RS15450 (FGF55_15450) | - | 3105801..3106199 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=328093 FGF55_RS15420 WP_003152043.1 3101362..3101502(-) (degQ) [Bacillus amyloliquefaciens strain ZJU1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=328093 FGF55_RS15420 WP_003152043.1 3101362..3101502(-) (degQ) [Bacillus amyloliquefaciens strain ZJU1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |