Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FGF55_RS15420 Genome accession   NZ_CP041691
Coordinates   3101362..3101502 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ZJU1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3096362..3106502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGF55_RS15395 (FGF55_15395) - 3096676..3097059 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  FGF55_RS15400 (FGF55_15400) comA 3097081..3097725 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  FGF55_RS15405 (FGF55_15405) comP 3097806..3100157 (-) 2352 WP_269800792.1 histidine kinase Regulator
  FGF55_RS15410 (FGF55_15410) comX 3100135..3100305 (-) 171 WP_032863917.1 competence pheromone ComX -
  FGF55_RS15415 (FGF55_15415) comQ 3100305..3101231 (-) 927 WP_014721741.1 polyprenyl synthetase family protein Regulator
  FGF55_RS15420 (FGF55_15420) degQ 3101362..3101502 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FGF55_RS15430 (FGF55_15430) - 3101968..3102309 (+) 342 WP_014418765.1 hypothetical protein -
  FGF55_RS15435 (FGF55_15435) - 3102316..3103539 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  FGF55_RS15440 (FGF55_15440) - 3103669..3105135 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  FGF55_RS15445 (FGF55_15445) - 3105153..3105704 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  FGF55_RS15450 (FGF55_15450) - 3105801..3106199 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=328093 FGF55_RS15420 WP_003152043.1 3101362..3101502(-) (degQ) [Bacillus amyloliquefaciens strain ZJU1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=328093 FGF55_RS15420 WP_003152043.1 3101362..3101502(-) (degQ) [Bacillus amyloliquefaciens strain ZJU1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891