Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   EGH11_RS02745 Genome accession   NZ_CP034018
Coordinates   451660..452130 (+) Length   156 a.a.
NCBI ID   WP_169577278.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FQ82     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 452200..508984 451660..452130 flank 70


Gene organization within MGE regions


Location: 451660..508984
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGH11_RS02745 (EGH11_02745) pilL 451660..452130 (+) 471 WP_169577278.1 PilX family type IV pilin Machinery gene
  EGH11_RS02750 (EGH11_02750) - 452200..452508 (-) 309 WP_010951048.1 AzlD family protein -
  EGH11_RS02755 (EGH11_02755) - 452505..453214 (-) 710 Protein_455 AzlC family ABC transporter permease -
  EGH11_RS02760 (EGH11_02760) dut 453380..453832 (+) 453 WP_003690909.1 dUTP diphosphatase -
  EGH11_RS02765 (EGH11_02765) dapC 453910..455097 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  EGH11_RS02770 (EGH11_02770) yaaA 455253..456032 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  EGH11_RS02785 (EGH11_02785) - 456563..457765 (+) 1203 WP_071198138.1 integrase arm-type DNA-binding domain-containing protein -
  EGH11_RS02795 (EGH11_02795) - 458121..458390 (-) 270 WP_003687928.1 hypothetical protein -
  EGH11_RS02800 (EGH11_02800) - 458585..459268 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  EGH11_RS14555 - 459582..459815 (-) 234 Protein_462 hypothetical protein -
  EGH11_RS02810 (EGH11_02810) - 459926..460141 (-) 216 WP_003691538.1 hypothetical protein -
  EGH11_RS02815 (EGH11_02815) - 460193..460684 (-) 492 WP_010359966.1 siphovirus Gp157 family protein -
  EGH11_RS02820 (EGH11_02820) - 460681..460863 (-) 183 WP_003691535.1 hypothetical protein -
  EGH11_RS02825 (EGH11_02825) - 461003..461689 (-) 687 WP_012503754.1 hypothetical protein -
  EGH11_RS02830 (EGH11_02830) - 461758..461919 (-) 162 WP_003702497.1 hypothetical protein -
  EGH11_RS02835 (EGH11_02835) - 461916..462191 (-) 276 WP_064661611.1 hypothetical protein -
  EGH11_RS02840 (EGH11_02840) - 462344..462676 (-) 333 WP_003687946.1 hypothetical protein -
  EGH11_RS02845 (EGH11_02845) - 462817..463104 (-) 288 WP_082278089.1 hypothetical protein -
  EGH11_RS02850 (EGH11_02850) - 463101..463577 (-) 477 WP_012504141.1 hypothetical protein -
  EGH11_RS02855 (EGH11_02855) - 463610..463810 (-) 201 WP_048654497.1 hypothetical protein -
  EGH11_RS02860 (EGH11_02860) - 464008..464421 (-) 414 WP_003687963.1 hypothetical protein -
  EGH11_RS02865 (EGH11_02865) - 464418..464879 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  EGH11_RS02870 (EGH11_02870) - 464896..465333 (-) 438 WP_003687967.1 hypothetical protein -
  EGH11_RS02875 (EGH11_02875) - 465446..466162 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  EGH11_RS02880 (EGH11_02880) - 466231..466467 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  EGH11_RS02885 (EGH11_02885) - 466547..466702 (+) 156 WP_003691446.1 hypothetical protein -
  EGH11_RS02890 (EGH11_02890) - 466679..466867 (-) 189 WP_003706568.1 hypothetical protein -
  EGH11_RS02895 (EGH11_02895) - 467040..467267 (+) 228 WP_047949281.1 helix-turn-helix domain-containing protein -
  EGH11_RS02900 (EGH11_02900) - 467264..468229 (+) 966 WP_124693283.1 helix-turn-helix domain-containing protein -
  EGH11_RS02905 (EGH11_02905) - 468244..469026 (+) 783 WP_025456432.1 ATP-binding protein -
  EGH11_RS02910 (EGH11_02910) - 469019..469249 (+) 231 WP_012503490.1 hypothetical protein -
  EGH11_RS02915 (EGH11_02915) - 469340..469834 (+) 495 WP_082298905.1 DUF3310 domain-containing protein -
  EGH11_RS02920 (EGH11_02920) - 470011..470160 (+) 150 WP_003692854.1 hypothetical protein -
  EGH11_RS14055 - 470189..470470 (+) 282 WP_003689109.1 hypothetical protein -
  EGH11_RS02925 (EGH11_02925) - 470461..470841 (+) 381 WP_017147222.1 RusA family crossover junction endodeoxyribonuclease -
  EGH11_RS02935 (EGH11_02935) - 471108..471515 (+) 408 WP_003691430.1 hypothetical protein -
  EGH11_RS02940 (EGH11_02940) - 471731..472765 (+) 1035 WP_229690641.1 type I restriction endonuclease -
  EGH11_RS02945 (EGH11_02945) - 473564..474481 (+) 918 WP_124737170.1 KilA-N domain-containing protein -
  EGH11_RS02950 (EGH11_02950) - 474774..475223 (+) 450 WP_003689093.1 hypothetical protein -
  EGH11_RS02955 (EGH11_02955) terL 475285..476706 (+) 1422 WP_003689090.1 phage terminase large subunit -
  EGH11_RS02960 (EGH11_02960) - 476703..478850 (+) 2148 WP_003691423.1 phage portal protein -
  EGH11_RS02965 (EGH11_02965) - 478918..480075 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  EGH11_RS02970 (EGH11_02970) - 480116..481615 (+) 1500 WP_033910832.1 hypothetical protein -
  EGH11_RS13710 (EGH11_02975) - 481622..481984 (+) 363 WP_003689082.1 hypothetical protein -
  EGH11_RS02980 (EGH11_02980) - 481987..482517 (+) 531 WP_003689080.1 head-tail connector protein -
  EGH11_RS02985 (EGH11_02985) - 482517..482999 (+) 483 WP_003703855.1 HK97 gp10 family phage protein -
  EGH11_RS02990 (EGH11_02990) - 482996..483424 (+) 429 WP_003697213.1 hypothetical protein -
  EGH11_RS02995 (EGH11_02995) - 483450..484223 (+) 774 WP_003692869.1 hypothetical protein -
  EGH11_RS03000 (EGH11_03000) - 484284..484613 (+) 330 WP_003692871.1 hypothetical protein -
  EGH11_RS03005 (EGH11_03005) - 484625..484891 (+) 267 WP_003689070.1 hypothetical protein -
  EGH11_RS03010 (EGH11_03010) - 484891..485490 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  EGH11_RS03015 (EGH11_03015) - 485487..486341 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  EGH11_RS03020 (EGH11_03020) - 486343..486774 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  EGH11_RS03025 (EGH11_03025) - 486802..487080 (-) 279 WP_003689062.1 XRE family transcriptional regulator -
  EGH11_RS03030 (EGH11_03030) - 487320..491465 (+) 4146 WP_071198284.1 phage tail protein -
  EGH11_RS03035 (EGH11_03035) - 491577..491882 (+) 306 WP_003689058.1 hypothetical protein -
  EGH11_RS03040 (EGH11_03040) - 491953..492423 (+) 471 WP_025455988.1 hypothetical protein -
  EGH11_RS03045 (EGH11_03045) - 492424..492756 (+) 333 WP_003691408.1 hypothetical protein -
  EGH11_RS03050 (EGH11_03050) - 492884..493117 (-) 234 WP_003692884.1 hypothetical protein -
  EGH11_RS03055 (EGH11_03055) - 493125..493472 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  EGH11_RS03060 (EGH11_03060) - 493472..493708 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  EGH11_RS14405 - 493748..493873 (+) 126 WP_255294325.1 hypothetical protein -
  EGH11_RS03070 (EGH11_03070) - 493915..494454 (+) 540 WP_003691405.1 TIGR02594 family protein -
  EGH11_RS03075 (EGH11_03075) - 494455..494799 (+) 345 WP_003695464.1 hypothetical protein -
  EGH11_RS13320 - 494783..494956 (+) 174 WP_165865812.1 hypothetical protein -
  EGH11_RS03080 (EGH11_03080) - 495268..495417 (+) 150 WP_003691402.1 hypothetical protein -
  EGH11_RS03085 (EGH11_03085) - 495447..498494 (+) 3048 WP_061182278.1 tape measure protein -
  EGH11_RS03090 (EGH11_03090) - 498554..499033 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  EGH11_RS03100 (EGH11_03100) - 499375..500364 (-) 990 WP_003689040.1 site-specific integrase -
  EGH11_RS03110 (EGH11_03110) purM 501053..502087 (+) 1035 WP_003689038.1 phosphoribosylformylglycinamidine cyclo-ligase -
  EGH11_RS03120 (EGH11_03120) - 503085..503737 (+) 653 Protein_523 IS1595 family transposase -
  EGH11_RS03125 (EGH11_03125) - 503871..505898 (+) 2028 WP_003689037.1 BCCT family transporter -
  EGH11_RS03130 (EGH11_03130) - 505987..507540 (-) 1554 WP_003689036.1 fatty acid--CoA ligase -
  EGH11_RS14410 - 507591..507719 (+) 129 WP_255294324.1 hypothetical protein -
  EGH11_RS03135 (EGH11_03135) - 507791..508984 (-) 1194 WP_003700045.1 SGNH/GDSL hydrolase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17367.09 Da        Isoelectric Point: 9.1761

>NTDB_id=328090 EGH11_RS02745 WP_169577278.1 451660..452130(+) (pilL) [Neisseria gonorrhoeae strain FQ82]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSRLEIFVSGYKM
NPKIAKKYSVSVSVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 471 bp        

>NTDB_id=328090 EGH11_RS02745 WP_169577278.1 451660..452130(+) (pilL) [Neisseria gonorrhoeae strain FQ82]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAGACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGGTGT
TCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCACTT
CTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

98.089

100

0.987

  pilX Neisseria meningitidis 8013

84.713

100

0.853


Multiple sequence alignment