Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | EG882_RS08145 | Genome accession | NZ_CP033967 |
| Coordinates | 1560345..1560485 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain 1B-23 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1555345..1565485
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EG882_RS08115 (EG882_08115) | - | 1555649..1556047 (+) | 399 | WP_015240486.1 | DUF1694 domain-containing protein | - |
| EG882_RS08120 (EG882_08120) | - | 1556144..1556695 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| EG882_RS08125 (EG882_08125) | - | 1556713..1558179 (+) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| EG882_RS08130 (EG882_08130) | - | 1558309..1559532 (+) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| EG882_RS08135 (EG882_08135) | - | 1559539..1559880 (-) | 342 | WP_124692757.1 | hypothetical protein | - |
| EG882_RS08145 (EG882_08145) | degQ | 1560345..1560485 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| EG882_RS08150 (EG882_08150) | - | 1560637..1561512 (+) | 876 | WP_025285191.1 | polyprenyl synthetase family protein | - |
| EG882_RS08155 (EG882_08155) | comX | 1561527..1561703 (+) | 177 | WP_015240484.1 | competence pheromone ComX | - |
| EG882_RS08160 (EG882_08160) | comP | 1561722..1564028 (+) | 2307 | WP_124692758.1 | sensor histidine kinase | Regulator |
| EG882_RS08165 (EG882_08165) | comA | 1564109..1564753 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| EG882_RS08170 (EG882_08170) | - | 1564775..1565158 (+) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=327458 EG882_RS08145 WP_003152043.1 1560345..1560485(+) (degQ) [Bacillus velezensis strain 1B-23]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=327458 EG882_RS08145 WP_003152043.1 1560345..1560485(+) (degQ) [Bacillus velezensis strain 1B-23]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |