Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PmCQ6_RS06745 | Genome accession | NZ_CP033600 |
| Coordinates | 1473709..1474209 (+) | Length | 166 a.a. |
| NCBI ID | WP_005719438.1 | Uniprot ID | A0A9X3URY5 |
| Organism | Pasteurella multocida strain CQ6 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1473709..1529716 | 1473709..1474209 | within | 0 |
Gene organization within MGE regions
Location: 1473709..1529716
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PmCQ6_RS06745 (PmCQ6_006780) | ssb | 1473709..1474209 (+) | 501 | WP_005719438.1 | single-stranded DNA-binding protein | Machinery gene |
| PmCQ6_RS06750 (PmCQ6_006785) | tnpA | 1474392..1474851 (+) | 460 | Protein_1318 | IS200/IS605 family transposase | - |
| PmCQ6_RS06755 (PmCQ6_006795) | folD | 1475428..1476282 (-) | 855 | WP_005725034.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| PmCQ6_RS06770 (PmCQ6_006810) | - | 1476657..1477712 (-) | 1056 | WP_014391441.1 | site-specific integrase | - |
| PmCQ6_RS06775 (PmCQ6_006815) | - | 1477616..1477918 (-) | 303 | WP_075271365.1 | helix-turn-helix domain-containing protein | - |
| PmCQ6_RS06780 (PmCQ6_006820) | - | 1478102..1478824 (-) | 723 | WP_014391442.1 | phage antirepressor KilAC domain-containing protein | - |
| PmCQ6_RS06785 (PmCQ6_006825) | - | 1478835..1479056 (-) | 222 | WP_064775645.1 | hypothetical protein | - |
| PmCQ6_RS06790 (PmCQ6_006830) | - | 1479301..1480209 (-) | 909 | WP_015691048.1 | P63C domain-containing protein | - |
| PmCQ6_RS06795 (PmCQ6_006835) | - | 1480313..1480801 (-) | 489 | WP_064775646.1 | DUF551 domain-containing protein | - |
| PmCQ6_RS06805 (PmCQ6_006845) | - | 1481013..1481378 (-) | 366 | WP_016533502.1 | hypothetical protein | - |
| PmCQ6_RS06810 (PmCQ6_006850) | - | 1481375..1481974 (-) | 600 | WP_064775647.1 | hypothetical protein | - |
| PmCQ6_RS11430 | - | 1482025..1482450 (-) | 426 | WP_269452503.1 | DUF2303 family protein | - |
| PmCQ6_RS11435 | - | 1482488..1482811 (-) | 324 | WP_269452504.1 | DUF2303 family protein | - |
| PmCQ6_RS06820 (PmCQ6_006860) | - | 1482883..1483236 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| PmCQ6_RS06825 (PmCQ6_006865) | - | 1483279..1483470 (-) | 192 | WP_016533530.1 | hypothetical protein | - |
| PmCQ6_RS06830 (PmCQ6_006870) | ssb | 1483482..1483946 (-) | 465 | WP_016570065.1 | single-stranded DNA-binding protein | Machinery gene |
| PmCQ6_RS06835 (PmCQ6_006875) | - | 1483950..1484561 (-) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| PmCQ6_RS11310 | - | 1484625..1484855 (-) | 231 | WP_231730752.1 | hypothetical protein | - |
| PmCQ6_RS11315 | bet | 1484852..1485403 (-) | 552 | WP_231730753.1 | phage recombination protein Bet | - |
| PmCQ6_RS06845 (PmCQ6_006890) | - | 1485706..1486392 (-) | 687 | WP_156707170.1 | hypothetical protein | - |
| PmCQ6_RS11190 | - | 1486395..1486556 (-) | 162 | WP_014390707.1 | hypothetical protein | - |
| PmCQ6_RS06850 (PmCQ6_006895) | - | 1486570..1486806 (-) | 237 | WP_016570068.1 | hypothetical protein | - |
| PmCQ6_RS06855 (PmCQ6_006900) | - | 1486793..1487077 (-) | 285 | WP_064775602.1 | hypothetical protein | - |
| PmCQ6_RS06860 (PmCQ6_006905) | - | 1487225..1487455 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| PmCQ6_RS06865 (PmCQ6_006910) | - | 1487517..1488164 (-) | 648 | WP_016570070.1 | Bro-N domain-containing protein | - |
| PmCQ6_RS06870 (PmCQ6_006915) | - | 1488430..1488975 (-) | 546 | WP_016533491.1 | hypothetical protein | - |
| PmCQ6_RS11320 | - | 1489114..1489242 (-) | 129 | WP_023430120.1 | KilA-N domain-containing protein | - |
| PmCQ6_RS06880 (PmCQ6_006925) | - | 1489567..1489797 (-) | 231 | WP_016533507.1 | hypothetical protein | - |
| PmCQ6_RS06885 (PmCQ6_006930) | - | 1490416..1490799 (-) | 384 | WP_016533476.1 | hypothetical protein | - |
| PmCQ6_RS06890 (PmCQ6_006935) | - | 1490796..1491275 (-) | 480 | WP_016533477.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PmCQ6_RS06895 (PmCQ6_006940) | - | 1491278..1491541 (-) | 264 | WP_016533478.1 | type II toxin-antitoxin system HicA family toxin | - |
| PmCQ6_RS06900 (PmCQ6_006945) | - | 1491687..1492376 (-) | 690 | WP_064775603.1 | helix-turn-helix transcriptional regulator | - |
| PmCQ6_RS06905 (PmCQ6_006950) | - | 1492504..1492713 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| PmCQ6_RS06910 (PmCQ6_006955) | - | 1492734..1493009 (+) | 276 | WP_005756640.1 | hypothetical protein | - |
| PmCQ6_RS06915 (PmCQ6_006960) | - | 1493067..1493768 (+) | 702 | WP_064775604.1 | phage antirepressor KilAC domain-containing protein | - |
| PmCQ6_RS06920 (PmCQ6_006965) | - | 1493765..1494118 (+) | 354 | WP_014390722.1 | HNH endonuclease signature motif containing protein | - |
| PmCQ6_RS06925 (PmCQ6_006970) | - | 1494120..1495022 (+) | 903 | WP_016533442.1 | hypothetical protein | - |
| PmCQ6_RS06930 (PmCQ6_006975) | - | 1495022..1495711 (+) | 690 | WP_016533441.1 | replication protein P | - |
| PmCQ6_RS06935 (PmCQ6_006980) | - | 1495715..1496251 (+) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| PmCQ6_RS06940 (PmCQ6_006985) | - | 1496241..1496699 (+) | 459 | WP_016569985.1 | recombination protein NinB | - |
| PmCQ6_RS06945 (PmCQ6_006990) | - | 1496773..1496985 (+) | 213 | WP_016533468.1 | hypothetical protein | - |
| PmCQ6_RS06950 (PmCQ6_006995) | - | 1497073..1497675 (+) | 603 | WP_064775605.1 | recombination protein NinG | - |
| PmCQ6_RS06955 (PmCQ6_007000) | - | 1497675..1498040 (+) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| PmCQ6_RS06960 | - | 1498230..1498415 (+) | 186 | WP_143930513.1 | hypothetical protein | - |
| PmCQ6_RS06965 (PmCQ6_007005) | - | 1498629..1498889 (+) | 261 | WP_014391475.1 | holin | - |
| PmCQ6_RS06970 (PmCQ6_007010) | - | 1498886..1499416 (+) | 531 | WP_014667794.1 | lysozyme | - |
| PmCQ6_RS06975 (PmCQ6_007015) | - | 1499389..1499712 (+) | 324 | WP_014667795.1 | DUF2570 family protein | - |
| PmCQ6_RS06980 (PmCQ6_007020) | - | 1499618..1499899 (+) | 282 | WP_064775606.1 | hypothetical protein | - |
| PmCQ6_RS06985 (PmCQ6_007025) | - | 1499934..1500368 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PmCQ6_RS06990 (PmCQ6_007030) | - | 1500397..1500579 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| PmCQ6_RS06995 (PmCQ6_007035) | - | 1500662..1501159 (+) | 498 | WP_014390737.1 | terminase | - |
| PmCQ6_RS07000 (PmCQ6_007040) | - | 1501143..1502369 (+) | 1227 | WP_102822904.1 | PBSX family phage terminase large subunit | - |
| PmCQ6_RS07005 (PmCQ6_007045) | - | 1502384..1503829 (+) | 1446 | WP_016533291.1 | phage portal protein | - |
| PmCQ6_RS07010 (PmCQ6_007050) | - | 1503783..1504754 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| PmCQ6_RS07015 (PmCQ6_007055) | - | 1504769..1506115 (+) | 1347 | WP_016533290.1 | hypothetical protein | - |
| PmCQ6_RS07020 (PmCQ6_007060) | - | 1506115..1506549 (+) | 435 | WP_016533289.1 | hypothetical protein | - |
| PmCQ6_RS07025 (PmCQ6_007065) | - | 1506561..1507559 (+) | 999 | WP_016533288.1 | major capsid protein | - |
| PmCQ6_RS07030 (PmCQ6_007070) | - | 1507570..1507911 (+) | 342 | WP_156707171.1 | hypothetical protein | - |
| PmCQ6_RS11325 (PmCQ6_007075) | - | 1507892..1508260 (+) | 369 | WP_078819881.1 | hypothetical protein | - |
| PmCQ6_RS07040 (PmCQ6_007080) | - | 1508263..1508607 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| PmCQ6_RS07045 (PmCQ6_007085) | - | 1508612..1508983 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| PmCQ6_RS07050 (PmCQ6_007090) | - | 1508980..1509351 (+) | 372 | WP_016533319.1 | hypothetical protein | - |
| PmCQ6_RS07055 (PmCQ6_007095) | - | 1509363..1509845 (+) | 483 | WP_014390749.1 | phage tail protein | - |
| PmCQ6_RS07060 (PmCQ6_007100) | - | 1509899..1510570 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| PmCQ6_RS07065 (PmCQ6_007105) | - | 1510647..1511003 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| PmCQ6_RS07070 (PmCQ6_007110) | - | 1511079..1511897 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| PmCQ6_RS07075 (PmCQ6_007115) | - | 1512236..1513060 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| PmCQ6_RS07080 (PmCQ6_007120) | - | 1513112..1515556 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| PmCQ6_RS07085 (PmCQ6_007125) | - | 1515559..1515888 (+) | 330 | WP_099803088.1 | phage tail protein | - |
| PmCQ6_RS07090 (PmCQ6_007130) | - | 1515978..1516691 (+) | 714 | WP_102827076.1 | phage minor tail protein L | - |
| PmCQ6_RS07095 (PmCQ6_007135) | - | 1516695..1517438 (+) | 744 | WP_102827075.1 | C40 family peptidase | - |
| PmCQ6_RS07100 (PmCQ6_007140) | - | 1517381..1518001 (+) | 621 | WP_102827074.1 | tail assembly protein | - |
| PmCQ6_RS07105 (PmCQ6_007145) | - | 1518005..1521349 (+) | 3345 | WP_231730754.1 | phage tail protein | - |
| PmCQ6_RS11330 | - | 1521674..1522678 (+) | 1005 | WP_231730755.1 | hypothetical protein | - |
| PmCQ6_RS11335 | - | 1523333..1524766 (+) | 1434 | WP_231730756.1 | DUF1983 domain-containing protein | - |
| PmCQ6_RS07115 (PmCQ6_007155) | - | 1524814..1525140 (+) | 327 | WP_156707168.1 | hypothetical protein | - |
| PmCQ6_RS11340 | - | 1525280..1525759 (-) | 480 | WP_231730757.1 | transposase | - |
| PmCQ6_RS11345 | - | 1526195..1526404 (-) | 210 | WP_231730758.1 | helix-turn-helix domain-containing protein | - |
| PmCQ6_RS11465 (PmCQ6_007165) | tnpA | 1526450..1526866 (+) | 417 | Protein_1395 | IS200/IS605 family transposase | - |
| PmCQ6_RS07130 (PmCQ6_007170) | - | 1527871..1529106 (+) | 1236 | WP_014326375.1 | YadA-like family protein | - |
| PmCQ6_RS07135 (PmCQ6_007175) | - | 1529297..1529716 (+) | 420 | WP_014326376.1 | DUF417 family protein | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18673.68 Da Isoelectric Point: 5.3353
>NTDB_id=324236 PmCQ6_RS06745 WP_005719438.1 1473709..1474209(+) (ssb) [Pasteurella multocida strain CQ6]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTASPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTASPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=324236 PmCQ6_RS06745 WP_005719438.1 1473709..1474209(+) (ssb) [Pasteurella multocida strain CQ6]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGG
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTTCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGG
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTTCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
69.231 |
100 |
0.759 |
| ssb | Vibrio cholerae strain A1552 |
53.591 |
100 |
0.584 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |