Detailed information NTG0323346

Bioinformatically predicted

Overview

• Name: comGG/cglG
• Type: Machinery gene
• Locus tag: FDP16_RS10310
• Genome accession: NZ_CP040798
• Coordinates: 2086720..2087112 (-)
• Length: 130 a.a.
• NCBI ID: WP_176799579.1
• Uniprot ID: -
• Organism: Streptococcus sanguinis strain CGMH058
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2081720..2092112

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FDP16_RS10290 (FDP16_10750)	-	2082794..2083432 (-)	639	WP_176799576.1	type II CAAX prenyl endopeptidase Rce1 family protein	-
FDP16_RS10295 (FDP16_10755)	-	2083550..2084299 (-)	750	WP_176799577.1	CPBP family intramembrane glutamic endopeptidase	-
FDP16_RS10300 (FDP16_10760)	-	2084446..2085636 (-)	1191	WP_176799578.1	acetate kinase	-
FDP16_RS10305 (FDP16_10765)	comGH	2085673..2086638 (-)	966	WP_124765830.1	class I SAM-dependent methyltransferase	Machinery gene
FDP16_RS10310 (FDP16_10770)	comGG/cglG	2086720..2087112 (-)	393	WP_176799579.1	competence type IV pilus minor pilin ComGG	Machinery gene
FDP16_RS10315 (FDP16_10775)	comGF/cglF	2087093..2087530 (-)	438	WP_176799580.1	competence type IV pilus minor pilin ComGF	Machinery gene
FDP16_RS10320 (FDP16_10780)	comGE/cglE	2087514..2087807 (-)	294	WP_176799581.1	competence type IV pilus minor pilin ComGE	Machinery gene
FDP16_RS10325 (FDP16_10785)	comGD	2087773..2088207 (-)	435	WP_176799582.1	competence type IV pilus minor pilin ComGD	Machinery gene
FDP16_RS10330 (FDP16_10790)	comGC	2088167..2088484 (-)	318	WP_002896769.1	competence type IV pilus major pilin ComGC	Machinery gene
FDP16_RS10335 (FDP16_10795)	comGB	2088484..2089518 (-)	1035	WP_256254487.1	competence type IV pilus assembly protein ComGB	Machinery gene
FDP16_RS10340 (FDP16_10800)	comGA	2089448..2090389 (-)	942	WP_002896773.1	competence type IV pilus ATPase ComGA	Machinery gene
FDP16_RS10345 (FDP16_10805)	-	2090519..2090899 (-)	381	WP_176799584.1	DUF1033 family protein	-
FDP16_RS10350 (FDP16_10810)	-	2091038..2092099 (-)	1062	WP_176799585.1	zinc-dependent alcohol dehydrogenase family protein	-

Sequence

Protein

• Length: 130 a.a.
• Molecular weight: 14617.60 Da
• Isoelectric Point: 9.5370

>NTDB_id=323346 FDP16_RS10310 WP_176799579.1 2086720..2087112(-) (comGG/cglG) [Streptococcus sanguinis strain CGMH058]
MWKKKVEAGILLYALLMAAVFSLLLQFYLNRQVSSQRLQLFNGERTEAYAMAVLTKATAKDDSGEMEFEQGKASYRKQGK
NLEISSQLSSGHSYSFTFTISKKDEDKAKEDKKATDKKEKAISDEAGKSD

Nucleotide

• Length: 393 bp

>NTDB_id=323346 FDP16_RS10310 WP_176799579.1 2086720..2087112(-) (comGG/cglG) [Streptococcus sanguinis strain CGMH058]
GTGTGGAAGAAGAAAGTTGAGGCTGGTATTTTACTGTATGCGCTGCTGATGGCCGCTGTCTTTAGCCTGCTCCTGCAGTT
TTATCTCAACCGTCAAGTCAGCAGTCAGCGTTTACAGCTTTTCAACGGGGAAAGGACAGAAGCCTATGCAATGGCAGTTC
TTACAAAAGCTACAGCCAAGGATGATAGCGGTGAGATGGAGTTTGAGCAGGGAAAGGCATCCTACCGAAAGCAAGGGAAG
AATCTGGAAATCAGCAGTCAGCTCAGCAGCGGTCATTCCTATTCCTTTACTTTTACCATTTCTAAGAAGGATGAGGATAA
AGCAAAGGAAGACAAGAAAGCAACTGACAAAAAGGAGAAAGCGATTTCGGACGAAGCTGGTAAGTCGGACTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG/cglG	Streptococcus pneumoniae TIGR4	47.525	77.692	0.369
comGG/cglG	Streptococcus pneumoniae Rx1	47.525	77.692	0.369
comGG/cglG	Streptococcus pneumoniae D39	47.525	77.692	0.369
comGG/cglG	Streptococcus pneumoniae R6	47.525	77.692	0.369
comGG/cglG	Streptococcus mitis SK321	46.535	77.692	0.362
comGG/cglG	Streptococcus mitis NCTC 12261	47.475	76.154	0.362
comGG	Streptococcus mutans UA140	43.119	83.846	0.362
comGG	Streptococcus mutans UA159	43.119	83.846	0.362