Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   D9Y32_RS20995 Genome accession   NZ_CP033218
Coordinates   4023532..4023708 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain TCCC 11148     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 4018532..4028708
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9Y32_RS20980 (D9Y32_21005) gcvT 4019164..4020268 (-) 1105 Protein_4119 glycine cleavage system aminomethyltransferase GcvT -
  D9Y32_RS20985 (D9Y32_21010) - 4020861..4022540 (+) 1680 WP_142782882.1 DEAD/DEAH box helicase -
  D9Y32_RS20990 (D9Y32_21015) - 4022547..4023341 (+) 795 WP_003183441.1 YqhG family protein -
  D9Y32_RS20995 (D9Y32_21020) sinI 4023532..4023708 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  D9Y32_RS21000 (D9Y32_21025) sinR 4023742..4024077 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  D9Y32_RS21005 (D9Y32_21030) tasA 4024182..4024976 (-) 795 WP_142782737.1 biofilm matrix protein TasA -
  D9Y32_RS21010 (D9Y32_21035) sipW 4025050..4025634 (-) 585 WP_003183449.1 signal peptidase I SipW -
  D9Y32_RS21015 (D9Y32_21040) tapA 4025631..4026359 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  D9Y32_RS21020 (D9Y32_21045) - 4026636..4026956 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  D9Y32_RS21025 (D9Y32_21050) - 4026980..4027162 (-) 183 WP_003183456.1 YqzE family protein -
  D9Y32_RS21030 (D9Y32_21055) comGG 4027250..4027615 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  D9Y32_RS21035 (D9Y32_21060) comGF 4027628..4028116 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  D9Y32_RS21040 (D9Y32_21065) comGE 4028025..4028372 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=322754 D9Y32_RS20995 WP_003183444.1 4023532..4023708(+) (sinI) [Bacillus licheniformis strain TCCC 11148]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=322754 D9Y32_RS20995 WP_003183444.1 4023532..4023708(+) (sinI) [Bacillus licheniformis strain TCCC 11148]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment