Detailed information    

insolico Bioinformatically predicted

Overview

Name   rok   Type   Regulator
Locus tag   D9Y32_RS19265 Genome accession   NZ_CP033218
Coordinates   3714050..3714532 (-) Length   160 a.a.
NCBI ID   WP_009328420.1    Uniprot ID   -
Organism   Bacillus licheniformis strain TCCC 11148     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3671433..3722242 3714050..3714532 within 0


Gene organization within MGE regions


Location: 3671433..3722242
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9Y32_RS19040 (D9Y32_19065) - 3673001..3674521 (+) 1521 WP_142782660.1 hypothetical protein -
  D9Y32_RS19045 (D9Y32_19070) - 3674555..3675994 (+) 1440 WP_142782661.1 hypothetical protein -
  D9Y32_RS19050 (D9Y32_19075) - 3676019..3676621 (+) 603 WP_142782662.1 hypothetical protein -
  D9Y32_RS19055 (D9Y32_19080) - 3676662..3677678 (+) 1017 WP_021837892.1 hypothetical protein -
  D9Y32_RS19060 (D9Y32_19085) - 3677713..3678183 (+) 471 WP_009328375.1 hypothetical protein -
  D9Y32_RS19065 (D9Y32_19090) - 3678195..3678593 (+) 399 WP_095233947.1 hypothetical protein -
  D9Y32_RS19070 (D9Y32_19095) - 3678590..3678820 (+) 231 WP_142782663.1 hypothetical protein -
  D9Y32_RS19075 (D9Y32_19100) - 3678807..3679466 (+) 660 WP_142782664.1 hypothetical protein -
  D9Y32_RS19080 (D9Y32_19105) - 3679463..3679993 (+) 531 WP_080623929.1 hypothetical protein -
  D9Y32_RS19085 (D9Y32_19110) - 3679990..3680709 (+) 720 WP_142782665.1 hypothetical protein -
  D9Y32_RS19090 (D9Y32_19115) - 3680754..3681548 (+) 795 WP_080623927.1 hypothetical protein -
  D9Y32_RS19095 (D9Y32_19120) - 3681588..3681980 (+) 393 WP_080623926.1 collagen-like protein -
  D9Y32_RS19100 (D9Y32_19125) - 3682088..3682453 (+) 366 WP_142782666.1 lysozyme -
  D9Y32_RS19105 (D9Y32_19130) - 3682456..3683748 (+) 1293 WP_142782667.1 hypothetical protein -
  D9Y32_RS19110 (D9Y32_19135) - 3683760..3684074 (+) 315 WP_142782668.1 hypothetical protein -
  D9Y32_RS19115 (D9Y32_19140) - 3684071..3684259 (+) 189 WP_050820989.1 XkdX family protein -
  D9Y32_RS19120 (D9Y32_19145) - 3684297..3684782 (+) 486 WP_095266710.1 hypothetical protein -
  D9Y32_RS19125 (D9Y32_19150) - 3684783..3685202 (+) 420 WP_142782669.1 hypothetical protein -
  D9Y32_RS19130 (D9Y32_19155) - 3685216..3686217 (+) 1002 WP_142782881.1 site-specific integrase -
  D9Y32_RS19135 (D9Y32_19160) - 3686355..3687032 (+) 678 WP_016886023.1 type II toxin-antitoxin system PemK/MazF family toxin -
  D9Y32_RS19140 (D9Y32_19165) - 3687219..3687467 (-) 249 WP_258320547.1 hypothetical protein -
  D9Y32_RS19145 (D9Y32_19170) - 3687574..3688035 (+) 462 WP_142782670.1 hypothetical protein -
  D9Y32_RS19150 (D9Y32_19175) - 3688225..3688683 (+) 459 WP_043929247.1 hypothetical protein -
  D9Y32_RS19155 (D9Y32_19180) - 3688849..3689589 (-) 741 WP_142782671.1 hypothetical protein -
  D9Y32_RS19160 (D9Y32_19185) - 3689876..3690337 (-) 462 WP_142782672.1 hypothetical protein -
  D9Y32_RS19165 (D9Y32_19190) - 3690486..3691124 (+) 639 WP_142782673.1 immunity protein -
  D9Y32_RS19170 (D9Y32_19195) - 3691134..3691355 (-) 222 WP_232252093.1 helix-turn-helix domain-containing protein -
  D9Y32_RS19175 (D9Y32_19200) - 3691516..3691764 (+) 249 WP_043929252.1 hypothetical protein -
  D9Y32_RS19180 (D9Y32_19205) - 3691742..3694039 (+) 2298 WP_142782674.1 homing endonuclease associated repeat-containing protein -
  D9Y32_RS19185 (D9Y32_19210) - 3694023..3694274 (+) 252 WP_142782675.1 hypothetical protein -
  D9Y32_RS19190 (D9Y32_19215) - 3694356..3695747 (+) 1392 Protein_3758 phage tail tape measure protein -
  D9Y32_RS19195 (D9Y32_19220) - 3696024..3696401 (+) 378 Protein_3759 phage tail tape measure protein -
  D9Y32_RS23955 (D9Y32_19225) - 3696765..3701651 (+) 4887 WP_392387311.1 transglycosylase SLT domain-containing protein -
  D9Y32_RS19205 (D9Y32_19230) - 3701708..3702469 (+) 762 WP_142782678.1 distal tail protein Dit -
  D9Y32_RS19210 (D9Y32_19235) - 3702473..3705110 (+) 2638 Protein_3762 phage tail spike protein -
  D9Y32_RS19215 (D9Y32_19240) - 3705126..3705923 (+) 798 WP_142782679.1 hypothetical protein -
  D9Y32_RS19220 (D9Y32_19245) - 3705939..3707843 (+) 1905 WP_142782680.1 right-handed parallel beta-helix repeat-containing protein -
  D9Y32_RS19225 (D9Y32_19250) - 3707999..3709087 (+) 1089 WP_142782681.1 N-acetylmuramoyl-L-alanine amidase -
  D9Y32_RS19230 (D9Y32_19255) - 3709219..3709605 (+) 387 WP_021837858.1 hypothetical protein -
  D9Y32_RS19235 (D9Y32_19260) - 3709624..3709878 (+) 255 WP_009328416.1 phage holin -
  D9Y32_RS19240 (D9Y32_19265) - 3709897..3710196 (+) 300 WP_034291560.1 hypothetical protein -
  D9Y32_RS23775 (D9Y32_19270) - 3710404..3710481 (+) 78 WP_003180750.1 putative holin-like toxin -
  D9Y32_RS23780 - 3710884..3711012 (-) 129 WP_256692922.1 hypothetical protein -
  D9Y32_RS19250 (D9Y32_19275) - 3711009..3712115 (-) 1107 WP_009328417.1 tetratricopeptide repeat protein -
  D9Y32_RS19255 (D9Y32_19280) - 3712226..3713485 (-) 1260 WP_009328418.1 MFS transporter -
  D9Y32_RS19260 (D9Y32_19285) - 3713627..3713980 (-) 354 WP_009328419.1 hypothetical protein -
  D9Y32_RS19265 (D9Y32_19290) rok 3714050..3714532 (-) 483 WP_009328420.1 hypothetical protein Regulator
  D9Y32_RS19275 (D9Y32_19300) - 3714818..3715276 (-) 459 WP_009328421.1 SMI1/KNR4 family protein -
  D9Y32_RS19280 (D9Y32_19305) - 3715317..3715739 (-) 423 WP_009328422.1 SMI1/KNR4 family protein -
  D9Y32_RS19285 (D9Y32_19310) - 3715754..3716041 (-) 288 WP_142782682.1 HNH/ENDO VII family nuclease -
  D9Y32_RS19290 (D9Y32_19315) - 3716145..3716624 (-) 480 WP_075646820.1 antitoxin YezG family protein -
  D9Y32_RS19295 (D9Y32_19320) - 3716628..3718676 (-) 2049 WP_142782683.1 T7SS effector LXG polymorphic toxin -
  D9Y32_RS19300 (D9Y32_19325) - 3718835..3719395 (-) 561 WP_237711641.1 SMI1/KNR4 family protein -
  D9Y32_RS19305 (D9Y32_19330) - 3719412..3720401 (-) 990 WP_142782684.1 HNH endonuclease signature motif containing protein -
  D9Y32_RS19310 (D9Y32_19335) - 3720674..3722242 (-) 1569 WP_142782685.1 recombinase family protein -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 18464.27 Da        Isoelectric Point: 10.5742

>NTDB_id=322750 D9Y32_RS19265 WP_009328420.1 3714050..3714532(-) (rok) [Bacillus licheniformis strain TCCC 11148]
MFNEREALRLRLEQLNDKEIIVMRELREEREGIYSKLRELDKNQSNPPQVRESSSLMDLVSAAAQELKQSKSSSPRIQTN
NASQPFNKSITSIQREAALKILSMHKEGIRGAGLRKEIEKETGMKVKNMTTFMSGLMKHHPEIKKPGRGHYVIKREKSFE

Nucleotide


Download         Length: 483 bp        

>NTDB_id=322750 D9Y32_RS19265 WP_009328420.1 3714050..3714532(-) (rok) [Bacillus licheniformis strain TCCC 11148]
ATGTTTAATGAACGAGAAGCGTTACGTTTGAGGCTTGAGCAGCTAAACGATAAAGAAATTATTGTCATGAGAGAGCTCAG
AGAAGAACGAGAAGGTATTTATTCAAAGTTGCGCGAGTTGGACAAAAACCAGAGTAATCCTCCTCAAGTCAGAGAAAGCT
CTTCATTGATGGATTTAGTTAGCGCAGCAGCCCAAGAATTGAAACAGTCTAAAAGCTCATCTCCACGCATTCAGACAAAC
AATGCCTCGCAACCCTTTAATAAGTCTATAACATCTATACAGCGTGAAGCAGCACTTAAAATATTGAGTATGCATAAAGA
AGGCATTAGAGGGGCAGGGCTTCGTAAGGAAATTGAGAAAGAAACAGGCATGAAAGTTAAAAATATGACAACTTTTATGA
GCGGACTCATGAAACACCATCCTGAAATCAAAAAACCAGGCCGCGGTCATTATGTTATTAAGCGTGAAAAGTCCTTTGAG
TAG

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rok Bacillus subtilis subsp. subtilis str. 168

42.623

100

0.488

Multiple sequence alignment