Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D2B33_RS07090 Genome accession   NZ_CP033198
Coordinates   1340195..1340371 (-) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain FA6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1335195..1345371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2B33_RS07045 (D2B33_07085) comGE 1335525..1335872 (+) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -
  D2B33_RS07050 (D2B33_07090) comGF 1335787..1336269 (+) 483 WP_228119627.1 competence type IV pilus minor pilin ComGF -
  D2B33_RS07055 (D2B33_07095) comGG 1336281..1336646 (+) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  D2B33_RS07060 (D2B33_07100) - 1336735..1336917 (+) 183 WP_020452171.1 YqzE family protein -
  D2B33_RS07065 (D2B33_07105) - 1336947..1337267 (-) 321 WP_020452170.1 YqzG/YhdC family protein -
  D2B33_RS07070 (D2B33_07110) tapA 1337545..1338273 (+) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  D2B33_RS07075 (D2B33_07115) sipW 1338270..1338854 (+) 585 WP_020452168.1 signal peptidase I SipW -
  D2B33_RS07080 (D2B33_07120) tasA 1338927..1339721 (+) 795 WP_020452167.1 biofilm matrix protein TasA -
  D2B33_RS07085 (D2B33_07125) sinR 1339826..1340161 (-) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  D2B33_RS07090 (D2B33_07130) sinI 1340195..1340371 (-) 177 WP_020452165.1 anti-repressor SinI Regulator
  D2B33_RS07095 (D2B33_07135) - 1340562..1341356 (-) 795 WP_020452164.1 YqhG family protein -
  D2B33_RS07100 (D2B33_07140) - 1341363..1343042 (-) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  D2B33_RS07105 (D2B33_07145) gcvT 1343637..1344731 (+) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=322439 D2B33_RS07090 WP_020452165.1 1340195..1340371(-) (sinI) [Bacillus paralicheniformis strain FA6]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=322439 D2B33_RS07090 WP_020452165.1 1340195..1340371(-) (sinI) [Bacillus paralicheniformis strain FA6]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment