Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D9C08_RS20285 Genome accession   NZ_CP032872
Coordinates   3784562..3784702 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain 2KL1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3779562..3789702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C08_RS20260 (D9C08_20260) yuxO 3779839..3780219 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  D9C08_RS20265 (D9C08_20265) comA 3780238..3780882 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C08_RS20270 (D9C08_20270) comP 3780963..3783275 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  D9C08_RS20275 (D9C08_20275) comX 3783291..3783512 (-) 222 WP_014480704.1 competence pheromone ComX -
  D9C08_RS20280 (D9C08_20280) - 3783514..3784377 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  D9C08_RS20285 (D9C08_20285) degQ 3784562..3784702 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C08_RS20290 (D9C08_20290) - 3784924..3785049 (+) 126 WP_003228793.1 hypothetical protein -
  D9C08_RS20295 (D9C08_20295) - 3785164..3785532 (+) 369 WP_046381300.1 hypothetical protein -
  D9C08_RS20300 (D9C08_20300) pdeH 3785508..3786737 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  D9C08_RS20305 (D9C08_20305) pncB 3786873..3788345 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D9C08_RS20310 (D9C08_20310) pncA 3788361..3788912 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  D9C08_RS20315 (D9C08_20315) yueI 3789009..3789407 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=319958 D9C08_RS20285 WP_003220708.1 3784562..3784702(-) (degQ) [Bacillus subtilis subsp. subtilis strain 2KL1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=319958 D9C08_RS20285 WP_003220708.1 3784562..3784702(-) (degQ) [Bacillus subtilis subsp. subtilis strain 2KL1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment