Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C18_RS19460 Genome accession   NZ_CP032865
Coordinates   3648483..3648866 (+) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain N3-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3643483..3653866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C18_RS19425 (D9C18_19425) corA 3643937..3644890 (+) 954 WP_014480260.1 magnesium transporter CorA -
  D9C18_RS19430 (D9C18_19430) - 3644892..3645089 (+) 198 WP_014480259.1 CBS domain-containing protein -
  D9C18_RS19435 (D9C18_19435) comGA 3645301..3646371 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C18_RS19440 (D9C18_19440) comGB 3646358..3647395 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C18_RS19445 (D9C18_19445) comGC 3647409..3647705 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C18_RS19450 (D9C18_19450) comGD 3647695..3648126 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C18_RS19455 (D9C18_19455) comGE 3648110..3648457 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C18_RS19460 (D9C18_19460) comGF 3648483..3648866 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C18_RS19465 (D9C18_19465) comGG 3648867..3649241 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C18_RS19470 (D9C18_19470) spoIITA 3649312..3649491 (+) 180 WP_014480252.1 YqzE family protein -
  D9C18_RS19475 (D9C18_19475) yqzG 3649533..3649859 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C18_RS19480 (D9C18_19480) tapA 3650131..3650892 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C18_RS19485 (D9C18_19485) sipW 3650876..3651448 (+) 573 WP_003230181.1 signal peptidase I SipW -
  D9C18_RS19490 (D9C18_19490) tasA 3651512..3652297 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C18_RS19495 (D9C18_19495) sinR 3652390..3652725 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C18_RS19500 (D9C18_19500) sinI 3652759..3652932 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=319758 D9C18_RS19460 WP_014480254.1 3648483..3648866(+) (comGF) [Bacillus subtilis subsp. subtilis strain N3-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=319758 D9C18_RS19460 WP_014480254.1 3648483..3648866(+) (comGF) [Bacillus subtilis subsp. subtilis strain N3-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment