Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   D9C16_RS07505 Genome accession   NZ_CP032861
Coordinates   1331606..1331797 (-) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain N1-1     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 1326606..1336797
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C16_RS07480 (D9C16_07480) appD 1326943..1327929 (-) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -
  D9C16_RS07485 (D9C16_07485) yjaZ 1328121..1328906 (-) 786 WP_014479439.1 DUF2268 domain-containing protein -
  D9C16_RS07490 (D9C16_07490) fabF 1328982..1330223 (-) 1242 WP_014479438.1 beta-ketoacyl-ACP synthase II -
  D9C16_RS07495 (D9C16_07495) fabH 1330246..1331184 (-) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  D9C16_RS07500 (D9C16_07500) yjzB 1331349..1331576 (+) 228 WP_031600361.1 spore coat protein YjzB -
  D9C16_RS07505 (D9C16_07505) comZ 1331606..1331797 (-) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  D9C16_RS07510 (D9C16_07510) med 1331812..1332765 (-) 954 WP_014479436.1 transcriptional regulator Med Regulator
  D9C16_RS07515 (D9C16_07515) - 1332856..1333413 (-) 558 WP_014479435.1 hypothetical protein -
  D9C16_RS07520 (D9C16_07520) - 1333495..1334229 (-) 735 WP_014479433.1 hypothetical protein -
  D9C16_RS07525 (D9C16_07525) yjzD 1334478..1334663 (+) 186 WP_003245236.1 DUF2929 domain-containing protein -
  D9C16_RS07530 (D9C16_07530) yjzC 1334709..1334888 (-) 180 WP_003245356.1 YjzC family protein -
  D9C16_RS07535 (D9C16_07535) - 1335066..1336216 (+) 1151 WP_087614160.1 IS3 family transposase -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=319560 D9C16_RS07505 WP_003224559.1 1331606..1331797(-) (comZ) [Bacillus subtilis subsp. subtilis strain N1-1]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=319560 D9C16_RS07505 WP_003224559.1 1331606..1331797(-) (comZ) [Bacillus subtilis subsp. subtilis strain N1-1]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment