Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C12_RS14615 | Genome accession | NZ_CP032857 |
| Coordinates | 2721365..2721538 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain 2RL2-3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2716365..2726538
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C12_RS14600 (D9C12_14600) | gcvT | 2717165..2718253 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C12_RS14605 (D9C12_14605) | hepAA | 2718694..2720367 (+) | 1674 | WP_038829735.1 | SNF2-related protein | - |
| D9C12_RS14610 (D9C12_14610) | yqhG | 2720388..2721182 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C12_RS14615 (D9C12_14615) | sinI | 2721365..2721538 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C12_RS14620 (D9C12_14620) | sinR | 2721572..2721907 (+) | 336 | WP_121509422.1 | transcriptional regulator SinR | Regulator |
| D9C12_RS14625 (D9C12_14625) | tasA | 2722000..2722785 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C12_RS14630 (D9C12_14630) | sipW | 2722849..2723421 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C12_RS14635 (D9C12_14635) | tapA | 2723405..2724166 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C12_RS14640 (D9C12_14640) | yqzG | 2724438..2724764 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C12_RS14645 (D9C12_14645) | spoIITA | 2724806..2724985 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C12_RS14650 (D9C12_14650) | comGG | 2725056..2725430 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C12_RS14655 (D9C12_14655) | comGF | 2725431..2725814 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| D9C12_RS14660 (D9C12_14660) | comGE | 2725840..2726187 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=319414 D9C12_RS14615 WP_003230187.1 2721365..2721538(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2RL2-3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=319414 D9C12_RS14615 WP_003230187.1 2721365..2721538(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2RL2-3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |