Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   D9C11_RS17730 Genome accession   NZ_CP032855
Coordinates   3316342..3316533 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain PJ-7     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 3311342..3321533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C11_RS17700 (D9C11_17700) argF 3312206..3313165 (+) 960 WP_121591632.1 ornithine carbamoyltransferase -
  D9C11_RS17705 (D9C11_17705) yjzC 3313250..3313429 (+) 180 WP_003245356.1 YjzC family protein -
  D9C11_RS17710 (D9C11_17710) yjzD 3313476..3313661 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  D9C11_RS17715 (D9C11_17715) - 3313910..3314644 (+) 735 WP_041340422.1 hypothetical protein -
  D9C11_RS17720 (D9C11_17720) - 3314726..3315283 (+) 558 WP_017695676.1 hypothetical protein -
  D9C11_RS17725 (D9C11_17725) med 3315374..3316327 (+) 954 WP_041340417.1 transcriptional regulator Med Regulator
  D9C11_RS17730 (D9C11_17730) comZ 3316342..3316533 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  D9C11_RS17735 (D9C11_17735) yjzB 3316563..3316790 (-) 228 WP_121591633.1 spore coat protein YjzB -
  D9C11_RS17740 (D9C11_17740) fabH 3316955..3317893 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  D9C11_RS17745 (D9C11_17745) fabF 3317916..3319157 (+) 1242 WP_014479438.1 beta-ketoacyl-ACP synthase II -
  D9C11_RS17750 (D9C11_17750) yjaZ 3319233..3320018 (+) 786 WP_014479439.1 DUF2268 domain-containing protein -
  D9C11_RS17755 (D9C11_17755) appD 3320210..3321196 (+) 987 WP_121591634.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=319356 D9C11_RS17730 WP_003224559.1 3316342..3316533(+) (comZ) [Bacillus subtilis subsp. subtilis strain PJ-7]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=319356 D9C11_RS17730 WP_003224559.1 3316342..3316533(+) (comZ) [Bacillus subtilis subsp. subtilis strain PJ-7]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTTTCAATGGAGGCCATACAGCCATTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment