Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C11_RS02000 Genome accession   NZ_CP032855
Coordinates   341180..341353 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain PJ-7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 336180..346353
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C11_RS01985 (D9C11_01985) gcvT 336979..338067 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C11_RS01990 (D9C11_01990) hepAA 338509..340182 (+) 1674 WP_041334956.1 SNF2-related protein -
  D9C11_RS01995 (D9C11_01995) yqhG 340203..340997 (+) 795 WP_043857814.1 YqhG family protein -
  D9C11_RS02000 (D9C11_02000) sinI 341180..341353 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C11_RS02005 (D9C11_02005) sinR 341387..341722 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C11_RS02010 (D9C11_02010) tasA 341815..342600 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  D9C11_RS02015 (D9C11_02015) sipW 342665..343237 (-) 573 WP_072557060.1 signal peptidase I SipW -
  D9C11_RS02020 (D9C11_02020) - 343221..343493 (-) 273 Protein_402 amyloid fiber anchoring/assembly protein TapA -
  D9C11_RS02025 (D9C11_02025) - 343631..344755 (+) 1125 WP_014478926.1 IS4-like element IS4Bsu1 family transposase -
  D9C11_RS02030 (D9C11_02030) tapA 344900..345391 (-) 492 Protein_404 amyloid fiber anchoring/assembly protein TapA -
  D9C11_RS02035 (D9C11_02035) yqzG 345662..345988 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  D9C11_RS02040 (D9C11_02040) spoIITA 346030..346209 (-) 180 WP_014480252.1 YqzE family protein -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=319297 D9C11_RS02000 WP_003230187.1 341180..341353(+) (sinI) [Bacillus subtilis subsp. subtilis strain PJ-7]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=319297 D9C11_RS02000 WP_003230187.1 341180..341353(+) (sinI) [Bacillus subtilis subsp. subtilis strain PJ-7]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment