Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   D9C10_RS10785 Genome accession   NZ_CP032853
Coordinates   1955027..1955401 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. subtilis strain MH-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1950027..1960401
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C10_RS10745 (D9C10_10745) yqhG 1950359..1951153 (+) 795 WP_014480249.1 YqhG family protein -
  D9C10_RS10750 (D9C10_10750) sinI 1951336..1951509 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C10_RS10755 (D9C10_10755) sinR 1951543..1951878 (+) 336 WP_121548932.1 transcriptional regulator SinR Regulator
  D9C10_RS10760 (D9C10_10760) tasA 1951971..1952756 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C10_RS10765 (D9C10_10765) sipW 1952820..1953392 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C10_RS10770 (D9C10_10770) tapA 1953376..1954137 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C10_RS10775 (D9C10_10775) yqzG 1954409..1954735 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C10_RS10780 (D9C10_10780) spoIITA 1954777..1954956 (-) 180 WP_014480252.1 YqzE family protein -
  D9C10_RS10785 (D9C10_10785) comGG 1955027..1955401 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C10_RS10790 (D9C10_10790) comGF 1955402..1955785 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C10_RS10795 (D9C10_10795) comGE 1955811..1956158 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C10_RS10800 (D9C10_10800) comGD 1956142..1956573 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C10_RS10805 (D9C10_10805) comGC 1956563..1956859 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C10_RS10810 (D9C10_10810) comGB 1956873..1957910 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C10_RS10815 (D9C10_10815) comGA 1957897..1958967 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C10_RS10820 (D9C10_10820) - 1959179..1959376 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C10_RS10825 (D9C10_10825) corA 1959378..1960331 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=319242 D9C10_RS10785 WP_014480253.1 1955027..1955401(-) (comGG) [Bacillus subtilis subsp. subtilis strain MH-1]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=319242 D9C10_RS10785 WP_014480253.1 1955027..1955401(-) (comGG) [Bacillus subtilis subsp. subtilis strain MH-1]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment