Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   D5H27_RS09580 Genome accession   NZ_CP032506
Coordinates   2007010..2007324 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain JT3-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2002010..2012324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D5H27_RS09535 (D5H27_09415) sinI 2002691..2002864 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  D5H27_RS09540 (D5H27_09420) sinR 2002898..2003233 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D5H27_RS09545 (D5H27_09425) - 2003281..2004066 (-) 786 WP_032874027.1 TasA family protein -
  D5H27_RS09550 (D5H27_09430) - 2004131..2004715 (-) 585 WP_032874025.1 signal peptidase I -
  D5H27_RS09555 (D5H27_09435) tapA 2004687..2005358 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  D5H27_RS09560 (D5H27_09440) - 2005617..2005946 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  D5H27_RS09565 (D5H27_09445) - 2005987..2006166 (-) 180 WP_022552966.1 YqzE family protein -
  D5H27_RS09570 (D5H27_09450) comGG 2006223..2006600 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  D5H27_RS09575 (D5H27_09455) comGF 2006601..2007101 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  D5H27_RS09580 (D5H27_09460) comGE 2007010..2007324 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  D5H27_RS09585 (D5H27_09465) comGD 2007308..2007745 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  D5H27_RS09590 (D5H27_09470) comGC 2007735..2008001 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  D5H27_RS09595 (D5H27_09475) comGB 2008048..2009085 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  D5H27_RS09600 (D5H27_09480) comGA 2009072..2010142 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  D5H27_RS09605 (D5H27_09485) - 2010339..2011289 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=316524 D5H27_RS09580 WP_032874016.1 2007010..2007324(-) (comGE) [Bacillus velezensis strain JT3-1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=316524 D5H27_RS09580 WP_032874016.1 2007010..2007324(-) (comGE) [Bacillus velezensis strain JT3-1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment