Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   D5H27_RS09535 Genome accession   NZ_CP032506
Coordinates   2002691..2002864 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain JT3-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1997691..2007864
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D5H27_RS09520 (D5H27_09400) gcvT 1998505..1999605 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  D5H27_RS09525 (D5H27_09405) - 2000028..2001698 (+) 1671 WP_032874031.1 SNF2-related protein -
  D5H27_RS09530 (D5H27_09410) - 2001720..2002514 (+) 795 WP_007612541.1 YqhG family protein -
  D5H27_RS09535 (D5H27_09415) sinI 2002691..2002864 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  D5H27_RS09540 (D5H27_09420) sinR 2002898..2003233 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D5H27_RS09545 (D5H27_09425) - 2003281..2004066 (-) 786 WP_032874027.1 TasA family protein -
  D5H27_RS09550 (D5H27_09430) - 2004131..2004715 (-) 585 WP_032874025.1 signal peptidase I -
  D5H27_RS09555 (D5H27_09435) tapA 2004687..2005358 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  D5H27_RS09560 (D5H27_09440) - 2005617..2005946 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  D5H27_RS09565 (D5H27_09445) - 2005987..2006166 (-) 180 WP_022552966.1 YqzE family protein -
  D5H27_RS09570 (D5H27_09450) comGG 2006223..2006600 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  D5H27_RS09575 (D5H27_09455) comGF 2006601..2007101 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  D5H27_RS09580 (D5H27_09460) comGE 2007010..2007324 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  D5H27_RS09585 (D5H27_09465) comGD 2007308..2007745 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=316521 D5H27_RS09535 WP_032874029.1 2002691..2002864(+) (sinI) [Bacillus velezensis strain JT3-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=316521 D5H27_RS09535 WP_032874029.1 2002691..2002864(+) (sinI) [Bacillus velezensis strain JT3-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment