Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4L09_RS07455 Genome accession   NZ_CP032474
Coordinates   1507084..1507197 (-) Length   37 a.a.
NCBI ID   WP_139546586.1    Uniprot ID   -
Organism   Helicobacter pylori strain 476-C-EK5     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1502084..1512197
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4L09_RS07435 - 1502756..1504174 (-) 1419 WP_139549018.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4L09_RS07440 comB10 1504244..1505380 (-) 1137 WP_139549019.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4L09_RS07445 comB9 1505373..1506350 (-) 978 WP_139549020.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4L09_RS07450 comB8 1506350..1507087 (-) 738 WP_108297487.1 virB8 family protein Machinery gene
  D4L09_RS07455 comB7 1507084..1507197 (-) 114 WP_139546586.1 comB7 lipoprotein Machinery gene
  D4L09_RS07460 comB6 1507213..1508268 (-) 1056 WP_139546619.1 P-type conjugative transfer protein TrbL Machinery gene
  D4L09_RS07465 - 1508276..1509271 (-) 996 WP_139549037.1 PDZ domain-containing protein -
  D4L09_RS07470 - 1509271..1509564 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4L09_RS07475 panD 1509567..1509920 (-) 354 WP_139542481.1 aspartate 1-decarboxylase -
  D4L09_RS07480 - 1509910..1512135 (-) 2226 WP_139546587.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4353.30 Da        Isoelectric Point: 9.3572

>NTDB_id=316197 D4L09_RS07455 WP_139546586.1 1507084..1507197(-) (comB7) [Helicobacter pylori strain 476-C-EK5]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLV

Nucleotide


Download         Length: 114 bp        

>NTDB_id=316197 D4L09_RS07455 WP_139546586.1 1507084..1507197(-) (comB7) [Helicobacter pylori strain 476-C-EK5]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGTATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973

Multiple sequence alignment