Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLB26_RS12965 | Genome accession | NZ_CP032435 |
| Coordinates | 2074656..2074844 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain B26 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2069656..2079844
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLB26_RS10315 (LLB26_2032) | - | 2070582..2071391 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLB26_RS10320 (LLB26_2033) | - | 2071384..2072121 (-) | 738 | WP_015082929.1 | metal ABC transporter ATP-binding protein | - |
| LLB26_RS10325 (LLB26_2034) | - | 2072300..2073142 (-) | 843 | WP_011677179.1 | zinc ABC transporter substrate-binding protein | - |
| LLB26_RS10330 (LLB26_2035) | - | 2073139..2073576 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLB26_RS10335 | comGG | 2073656..2073955 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLB26_RS10340 (LLB26_2036) | comGF | 2073979..2074425 (-) | 447 | WP_015082930.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLB26_RS10345 (LLB26_2037) | comGE | 2074388..2074624 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLB26_RS12965 | comGD | 2074656..2074844 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLB26_RS10355 (LLB26_2038) | comGC | 2075046..2075423 (-) | 378 | WP_015082932.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLB26_RS10360 (LLB26_2039) | comGB | 2075441..2076466 (-) | 1026 | WP_051013189.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLB26_RS10365 (LLB26_2040) | comGA | 2076366..2077346 (-) | 981 | WP_015082934.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=315896 LLB26_RS12965 WP_014573336.1 2074656..2074844(-) (comGD) [Lactococcus cremoris strain B26]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=315896 LLB26_RS12965 WP_014573336.1 2074656..2074844(-) (comGD) [Lactococcus cremoris strain B26]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |