Detailed information    

insolico Bioinformatically predicted

Overview


Name   clpX   Type   Regulator
Locus tag   D5R90_RS00695 Genome accession   NZ_CP032400
Coordinates   143974..145203 (-) Length   409 a.a.
NCBI ID   WP_003099812.1    Uniprot ID   -
Organism   Streptococcus iniae strain YM011     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 124615..197593 143974..145203 within 0


Gene organization within MGE regions


Location: 124615..197593
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D5R90_RS00590 (D5R90_00590) - 124615..125769 (-) 1155 WP_003099772.1 ABC transporter ATP-binding protein -
  D5R90_RS00595 (D5R90_00595) murB 125804..126697 (-) 894 WP_003099774.1 UDP-N-acetylmuramate dehydrogenase -
  D5R90_RS00600 (D5R90_00600) - 126952..128118 (+) 1167 WP_003099776.1 IS30 family transposase -
  D5R90_RS00605 (D5R90_00605) folK 128370..128861 (-) 492 WP_003099778.1 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase -
  D5R90_RS00610 (D5R90_00610) folB 128858..129217 (-) 360 WP_003099779.1 dihydroneopterin aldolase -
  D5R90_RS00615 (D5R90_00615) folP 129224..130024 (-) 801 WP_003099781.1 dihydropteroate synthase -
  D5R90_RS00620 (D5R90_00620) folE 130034..130597 (-) 564 WP_003099782.1 GTP cyclohydrolase I FolE -
  D5R90_RS00625 (D5R90_00625) - 130626..131885 (-) 1260 WP_003099784.1 folylpolyglutamate synthase/dihydrofolate synthase family protein -
  D5R90_RS00630 (D5R90_00630) thrB 131969..132829 (-) 861 WP_003099786.1 homoserine kinase -
  D5R90_RS00635 (D5R90_00635) - 132831..134117 (-) 1287 WP_016356020.1 homoserine dehydrogenase -
  D5R90_RS00640 (D5R90_00640) - 134302..135222 (+) 921 WP_003099793.1 polysaccharide deacetylase family protein -
  D5R90_RS00645 (D5R90_00645) - 135482..136657 (+) 1176 WP_003099056.1 IS256 family transposase -
  D5R90_RS00660 (D5R90_00660) tnpA 138175..138615 (-) 441 WP_003099798.1 IS200/IS605 family transposase -
  D5R90_RS00665 (D5R90_00665) rplL 138838..139203 (-) 366 WP_003099800.1 50S ribosomal protein L7/L12 -
  D5R90_RS00670 (D5R90_00670) rplJ 139267..139767 (-) 501 WP_003099802.1 50S ribosomal protein L10 -
  D5R90_RS00675 (D5R90_00675) - 140031..140984 (-) 954 WP_003098612.1 IS30 family transposase -
  D5R90_RS00680 (D5R90_00680) - 141130..142472 (-) 1343 Protein_136 IS3 family transposase -
  D5R90_RS00685 (D5R90_00685) - 142544..143257 (-) 714 WP_003099809.1 hypothetical protein -
  D5R90_RS00690 (D5R90_00690) yihA 143365..143964 (-) 600 WP_003099810.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  D5R90_RS00695 (D5R90_00695) clpX 143974..145203 (-) 1230 WP_003099812.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  D5R90_RS00705 (D5R90_00705) - 145428..145925 (-) 498 WP_003099817.1 dihydrofolate reductase -
  D5R90_RS00710 (D5R90_00710) - 146004..146843 (-) 840 WP_017794807.1 thymidylate synthase -
  D5R90_RS00715 (D5R90_00715) - 147039..148211 (+) 1173 WP_003099823.1 hydroxymethylglutaryl-CoA synthase -
  D5R90_RS00720 (D5R90_00720) - 148201..149478 (+) 1278 WP_003099827.1 hydroxymethylglutaryl-CoA reductase, degradative -
  D5R90_RS00725 (D5R90_00725) fni 149502..150497 (-) 996 WP_003099830.1 type 2 isopentenyl-diphosphate Delta-isomerase -
  D5R90_RS00730 (D5R90_00730) - 150478..151497 (-) 1020 WP_003099834.1 phosphomevalonate kinase -
  D5R90_RS00735 (D5R90_00735) mvaD 151490..152434 (-) 945 WP_003099837.1 diphosphomevalonate decarboxylase -
  D5R90_RS00740 (D5R90_00740) mvk 152410..153294 (-) 885 WP_003099844.1 mevalonate kinase -
  D5R90_RS00745 (D5R90_00745) - 153425..155167 (-) 1743 WP_003099847.1 ABC transporter ATP-binding protein -
  D5R90_RS00750 (D5R90_00750) - 155169..156890 (-) 1722 WP_003099849.1 ABC transporter ATP-binding protein -
  D5R90_RS00755 (D5R90_00755) - 157466..159496 (+) 2031 WP_003099850.1 5'-nucleotidase C-terminal domain-containing protein -
  D5R90_RS00760 (D5R90_00760) - 159532..159942 (-) 411 WP_003099851.1 peptide deformylase -
  D5R90_RS00765 (D5R90_00765) gdhA 160022..161371 (-) 1350 WP_003099852.1 NADP-specific glutamate dehydrogenase -
  D5R90_RS00770 (D5R90_00770) - 161505..163271 (-) 1767 WP_003099853.1 ABC transporter ATP-binding protein -
  D5R90_RS00775 (D5R90_00775) - 163271..165013 (-) 1743 WP_003099854.1 ABC transporter ATP-binding protein -
  D5R90_RS00780 (D5R90_00780) - 165115..165594 (-) 480 WP_003099856.1 GNAT family N-acetyltransferase -
  D5R90_RS00785 (D5R90_00785) - 165596..167482 (-) 1887 WP_003099861.1 ABC-F family ATP-binding cassette domain-containing protein -
  D5R90_RS00790 (D5R90_00790) - 167479..168687 (-) 1209 WP_003099863.1 CCA tRNA nucleotidyltransferase -
  D5R90_RS00795 (D5R90_00795) dapB 168684..169451 (-) 768 WP_003099866.1 4-hydroxy-tetrahydrodipicolinate reductase -
  D5R90_RS00800 (D5R90_00800) - 169468..170319 (-) 852 WP_016356025.1 DegV family protein -
  D5R90_RS00805 (D5R90_00805) - 170319..170699 (-) 381 WP_003099871.1 DUF1149 family protein -
  D5R90_RS00810 (D5R90_00810) - 170772..171293 (-) 522 WP_003099873.1 hypothetical protein -
  D5R90_RS00815 (D5R90_00815) tnpA 171490..171963 (+) 474 WP_003099875.1 IS200/IS605 family transposase -
  D5R90_RS00820 (D5R90_00820) - 172102..172822 (-) 721 Protein_163 glucosaminidase domain-containing protein -
  D5R90_RS00825 (D5R90_00825) - 172992..173606 (-) 615 WP_016356029.1 glycoside hydrolase family 73 protein -
  D5R90_RS00830 (D5R90_00830) - 173695..175647 (-) 1953 WP_003099880.1 fructose-specific PTS transporter subunit EIIC -
  D5R90_RS00835 (D5R90_00835) pfkB 175644..176555 (-) 912 WP_003099882.1 1-phosphofructokinase -
  D5R90_RS00840 (D5R90_00840) - 176552..177265 (-) 714 WP_003099883.1 DeoR/GlpR family DNA-binding transcription regulator -
  D5R90_RS00845 (D5R90_00845) - 177427..178350 (-) 924 WP_003099884.1 2-dehydropantoate 2-reductase -
  D5R90_RS00850 (D5R90_00850) - 178369..179369 (-) 1001 Protein_169 PTS sugar transporter subunit IIC -
  D5R90_RS00855 (D5R90_00855) - 179505..180503 (-) 999 WP_003099886.1 NAD(P)/FAD-dependent oxidoreductase -
  D5R90_RS00860 (D5R90_00860) trmD 180496..181236 (-) 741 WP_016356032.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  D5R90_RS00865 (D5R90_00865) rimM 181226..181744 (-) 519 WP_003099888.1 ribosome maturation factor RimM -
  D5R90_RS00870 (D5R90_00870) - 181999..183528 (-) 1530 WP_003099889.1 collagen binding domain-containing protein -
  D5R90_RS00875 (D5R90_00875) - 183700..183939 (-) 240 WP_003082623.1 KH domain-containing protein -
  D5R90_RS00880 (D5R90_00880) rpsP 183949..184221 (-) 273 WP_003099891.1 30S ribosomal protein S16 -
  D5R90_RS00885 (D5R90_00885) - 184492..185100 (-) 609 WP_003099892.1 TVP38/TMEM64 family protein -
  D5R90_RS00890 (D5R90_00890) - 185093..186295 (-) 1203 WP_016356033.1 ABC transporter permease -
  D5R90_RS00895 (D5R90_00895) - 186307..187020 (-) 714 WP_016356034.1 ABC transporter ATP-binding protein -
  D5R90_RS00900 (D5R90_00900) - 187039..188283 (-) 1245 WP_016356035.1 efflux RND transporter periplasmic adaptor subunit -
  D5R90_RS00905 (D5R90_00905) - 188550..189809 (-) 1260 WP_003099896.1 uracil-xanthine permease family protein -
  D5R90_RS00910 (D5R90_00910) pyrR 189824..190345 (-) 522 WP_016356036.1 bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR -
  D5R90_RS00915 (D5R90_00915) - 190549..191448 (-) 900 WP_003099901.1 RluA family pseudouridine synthase -
  D5R90_RS00920 (D5R90_00920) lspA 191449..191895 (-) 447 WP_003099904.1 signal peptidase II -
  D5R90_RS00925 (D5R90_00925) - 191892..192806 (-) 915 WP_003099906.1 LysR family transcriptional regulator -
  D5R90_RS00930 (D5R90_00930) rpmA 192951..193244 (-) 294 WP_003099908.1 50S ribosomal protein L27 -
  D5R90_RS00935 (D5R90_00935) - 193272..193595 (-) 324 WP_016356038.1 ribosomal-processing cysteine protease Prp -
  D5R90_RS00940 (D5R90_00940) rplU 193603..193917 (-) 315 WP_003099910.1 50S ribosomal protein L21 -
  D5R90_RS00945 (D5R90_00945) - 194229..195182 (+) 954 WP_003098714.1 IS30 family transposase -
  D5R90_RS00950 (D5R90_00950) - 195314..196225 (+) 912 WP_003099911.1 nucleoside hydrolase -
  D5R90_RS00955 (D5R90_00955) - 196309..196422 (+) 114 Protein_190 CPBP family intramembrane glutamate endopeptidase -
  D5R90_RS00960 (D5R90_00960) - 196482..197593 (+) 1112 WP_089180045.1 IS3-like element IS981 family transposase -

Sequence


Protein


Download         Length: 409 a.a.        Molecular weight: 45151.78 Da        Isoelectric Point: 4.4847

>NTDB_id=315418 D5R90_RS00695 WP_003099812.1 143974..145203(-) (clpX) [Streptococcus iniae strain YM011]
MAVNRTNDIKVHCSFCGKDQDEVKKIIAGNNVFICDECVALSQEIIKEELAEEVLADLTEVPKPKELLDILNQYVVGQDH
AKKALAVAVYNHYKRVSFTESRDEDEVELQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATSLTEAGYVGEDVENI
LLKLIQAADYNVERAERGIIYVDEIDKIAKKGENVSITRDVSGEGVQQALLKIIEGTEASVPPQGGRKHPNQEMIQIDTK
NILFIVGGAFDGIEEIVKQRLGEKIIGFGQNSRKIDEDASYMQEIIAEDIQKFGLIPEFIGRLPVVAALEQLTVADLIQI
LTEPRNALVKQYQALLSYDGVELEFEKAALEAIAAKAIERKTGARGLRSIIEETMLDIMFEIPSQEDVIKVRITKDSVDG
LKKPILETA

Nucleotide


Download         Length: 1230 bp        

>NTDB_id=315418 D5R90_RS00695 WP_003099812.1 143974..145203(-) (clpX) [Streptococcus iniae strain YM011]
ATGGCAGTTAATCGTACAAACGATATTAAGGTCCATTGTTCATTTTGTGGCAAGGACCAAGATGAAGTTAAAAAAATTAT
TGCAGGGAACAATGTTTTCATCTGTGATGAATGTGTTGCATTATCTCAAGAAATTATAAAAGAAGAATTAGCAGAGGAAG
TATTAGCTGATTTAACGGAAGTTCCAAAACCAAAAGAACTTTTAGATATTTTAAATCAATATGTTGTTGGTCAAGACCAT
GCTAAAAAGGCTTTAGCAGTAGCAGTTTATAACCATTATAAGCGTGTTTCGTTTACAGAAAGTCGCGATGAAGATGAAGT
GGAATTGCAAAAGTCAAATATTCTCATGATTGGCCCAACTGGTTCAGGAAAAACCTTCTTGGCACAAACTTTGGCAAAAA
GTTTAAATGTACCATTTGCCATTGCGGATGCTACTTCATTAACTGAAGCTGGCTATGTCGGCGAAGATGTTGAGAATATT
CTGCTAAAATTAATTCAAGCAGCTGATTATAATGTAGAACGTGCAGAACGTGGCATTATTTATGTTGATGAAATTGATAA
AATTGCTAAAAAAGGGGAAAATGTTTCCATTACACGCGATGTCTCTGGTGAAGGTGTTCAACAAGCCCTGCTAAAAATTA
TTGAAGGCACAGAAGCAAGTGTTCCACCTCAAGGTGGACGTAAACACCCTAATCAAGAGATGATTCAAATTGATACGAAA
AATATTTTGTTCATCGTTGGTGGCGCTTTTGATGGCATTGAAGAAATTGTTAAACAGCGTCTTGGAGAAAAAATTATTGG
TTTTGGCCAAAATAGCCGTAAAATTGATGAAGATGCTTCATATATGCAAGAAATTATCGCAGAAGACATTCAAAAATTTG
GCCTTATTCCAGAATTTATTGGACGCTTACCTGTTGTTGCAGCCTTAGAACAGTTAACAGTTGCTGACCTGATTCAAATT
TTAACAGAACCAAGAAATGCTCTTGTTAAACAATACCAAGCTCTTTTATCTTATGATGGTGTTGAACTTGAATTTGAAAA
GGCTGCTTTGGAAGCTATTGCTGCAAAAGCTATAGAACGTAAAACTGGTGCGCGTGGCCTTCGTTCAATCATTGAAGAAA
CCATGCTTGACATTATGTTTGAAATCCCTAGTCAAGAAGATGTTATTAAGGTTCGCATTACTAAGGACTCTGTGGATGGG
CTTAAAAAACCTATTTTGGAAACGGCATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

87.775

100

0.878

  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

57.895

97.555

0.565


Multiple sequence alignment