Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   D3C60_RS15115 Genome accession   NZ_CP032144
Coordinates   3057643..3057783 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BIM B-439D     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3052643..3062783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D3C60_RS15090 (D3C60_15090) - 3052939..3053322 (-) 384 WP_032869799.1 hotdog fold thioesterase -
  D3C60_RS15095 (D3C60_15095) comA 3053344..3053988 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  D3C60_RS15100 (D3C60_15100) comP 3054069..3056378 (-) 2310 WP_033574914.1 histidine kinase Regulator
  D3C60_RS15105 (D3C60_15105) comX 3056398..3056574 (-) 177 WP_007408675.1 competence pheromone ComX -
  D3C60_RS15110 (D3C60_15110) comQ 3056574..3057512 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  D3C60_RS15115 (D3C60_15115) degQ 3057643..3057783 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  D3C60_RS15125 (D3C60_15125) - 3058246..3058587 (+) 342 WP_007408677.1 hypothetical protein -
  D3C60_RS15130 (D3C60_15130) - 3058594..3059817 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  D3C60_RS15135 (D3C60_15135) - 3059947..3061413 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  D3C60_RS15140 (D3C60_15140) - 3061431..3061982 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  D3C60_RS15145 (D3C60_15145) - 3062079..3062477 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=313948 D3C60_RS15115 WP_003152043.1 3057643..3057783(-) (degQ) [Bacillus velezensis strain BIM B-439D]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=313948 D3C60_RS15115 WP_003152043.1 3057643..3057783(-) (degQ) [Bacillus velezensis strain BIM B-439D]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment