Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   D3C60_RS11925 Genome accession   NZ_CP032144
Coordinates   2451747..2452013 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain BIM B-439D     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2446747..2457013
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D3C60_RS11875 (D3C60_11875) sinR 2446911..2447246 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  D3C60_RS11880 (D3C60_11880) - 2447294..2448079 (-) 786 WP_007408329.1 TasA family protein -
  D3C60_RS11885 (D3C60_11885) - 2448144..2448728 (-) 585 WP_015240205.1 signal peptidase I -
  D3C60_RS11890 (D3C60_11890) tapA 2448700..2449371 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  D3C60_RS11895 (D3C60_11895) - 2449630..2449959 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  D3C60_RS11900 (D3C60_11900) - 2449999..2450178 (-) 180 WP_003153093.1 YqzE family protein -
  D3C60_RS11905 (D3C60_11905) comGG 2450235..2450612 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  D3C60_RS11910 (D3C60_11910) comGF 2450613..2451113 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  D3C60_RS11915 (D3C60_11915) comGE 2451022..2451336 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  D3C60_RS11920 (D3C60_11920) comGD 2451320..2451757 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  D3C60_RS11925 (D3C60_11925) comGC 2451747..2452013 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  D3C60_RS11930 (D3C60_11930) comGB 2452060..2453097 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  D3C60_RS11935 (D3C60_11935) comGA 2453084..2454154 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  D3C60_RS11940 (D3C60_11940) - 2454346..2455296 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  D3C60_RS11945 (D3C60_11945) - 2455442..2456743 (+) 1302 WP_032866438.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=313930 D3C60_RS11925 WP_042635730.1 2451747..2452013(-) (comGC) [Bacillus velezensis strain BIM B-439D]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=313930 D3C60_RS11925 WP_042635730.1 2451747..2452013(-) (comGC) [Bacillus velezensis strain BIM B-439D]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment