Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   D1O36_RS08095 Genome accession   NZ_CP031881
Coordinates   1501564..1502640 (-) Length   358 a.a.
NCBI ID   WP_022096499.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain ST106     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1496251..1565844 1501564..1502640 within 0


Gene organization within MGE regions


Location: 1496251..1565844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D1O36_RS08070 (D1O36_08100) - 1496275..1497057 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  D1O36_RS08075 (D1O36_08105) - 1497676..1499742 (-) 2067 WP_022096502.1 sodium:proton antiporter -
  D1O36_RS08080 (D1O36_08110) - 1499751..1499993 (-) 243 WP_011226461.1 hypothetical protein -
  D1O36_RS08085 (D1O36_08115) - 1499990..1500538 (-) 549 WP_011226462.1 class I SAM-dependent methyltransferase -
  D1O36_RS08090 (D1O36_08120) - 1500535..1501479 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  D1O36_RS08095 (D1O36_08125) sepM 1501564..1502640 (-) 1077 WP_022096499.1 SepM family pheromone-processing serine protease Regulator
  D1O36_RS08100 (D1O36_08130) coaD 1502618..1503115 (-) 498 WP_022096498.1 pantetheine-phosphate adenylyltransferase -
  D1O36_RS08105 (D1O36_08135) rsmD 1503149..1503748 (-) 600 Protein_1519 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  D1O36_RS08110 (D1O36_08140) trxB 1503839..1504792 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  D1O36_RS08115 (D1O36_08145) - 1504825..1505049 (-) 225 WP_011226468.1 DUF4059 family protein -
  D1O36_RS08120 (D1O36_08150) - 1505264..1506007 (-) 744 WP_134973451.1 amino acid ABC transporter ATP-binding protein -
  D1O36_RS08125 (D1O36_08155) - 1506007..1506753 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  D1O36_RS08130 (D1O36_08160) - 1507147..1507977 (-) 831 WP_134973453.1 transporter substrate-binding domain-containing protein -
  D1O36_RS08135 (D1O36_08165) - 1508486..1508719 (-) 234 WP_065972545.1 hypothetical protein -
  D1O36_RS08140 (D1O36_08170) dinB 1509005..1510108 (-) 1104 WP_011227504.1 DNA polymerase IV -
  D1O36_RS08145 (D1O36_08175) pflB 1510386..1512695 (+) 2310 WP_134973455.1 formate C-acetyltransferase -
  D1O36_RS08150 (D1O36_08180) - 1512962..1513744 (+) 783 Protein_1528 carbonic anhydrase family protein -
  D1O36_RS08155 (D1O36_08185) - 1513795..1514247 (+) 453 WP_167547751.1 GNAT family N-acetyltransferase -
  D1O36_RS08165 (D1O36_08195) - 1514599..1514922 (-) 324 WP_134973457.1 restriction endonuclease subunit S -
  D1O36_RS11250 (D1O36_08200) mobV 1514928..1515436 (-) 509 Protein_1531 MobV family relaxase -
  D1O36_RS08175 (D1O36_08205) fetB 1515885..1516640 (-) 756 WP_134973458.1 iron export ABC transporter permease subunit FetB -
  D1O36_RS08180 (D1O36_08210) - 1516637..1517287 (-) 651 WP_134973459.1 ATP-binding cassette domain-containing protein -
  D1O36_RS08190 (D1O36_08220) - 1517489..1518445 (-) 957 WP_084829079.1 serine hydrolase domain-containing protein -
  D1O36_RS08195 (D1O36_08225) - 1518445..1519200 (-) 756 WP_084829080.1 CppA family protein -
  D1O36_RS10850 - 1519482..1519619 (+) 138 WP_223899682.1 hypothetical protein -
  D1O36_RS10855 - 1519680..1519844 (+) 165 WP_231907516.1 CPBP family glutamic-type intramembrane protease -
  D1O36_RS08205 (D1O36_08235) gla 1519931..1520794 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  D1O36_RS08210 (D1O36_08240) - 1520915..1523182 (+) 2268 WP_134973460.1 Xaa-Pro dipeptidyl-peptidase -
  D1O36_RS08215 (D1O36_08245) - 1523262..1523642 (-) 381 WP_084829082.1 bacteriocin secretion protein -
  D1O36_RS08220 - 1523767..1524030 (-) 264 WP_002945924.1 hypothetical protein -
  D1O36_RS08225 (D1O36_08250) - 1524352..1524648 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  D1O36_RS08230 (D1O36_08255) - 1524813..1525739 (-) 927 WP_022096485.1 thioredoxin family protein -
  D1O36_RS08235 (D1O36_08260) - 1525933..1527503 (+) 1571 WP_134973462.1 IS3-like element ISSth1b family transposase -
  D1O36_RS08240 (D1O36_08265) - 1527649..1527903 (-) 255 WP_002951792.1 Blp family class II bacteriocin -
  D1O36_RS11255 (D1O36_08270) - 1528154..1528555 (-) 402 WP_011226490.1 hypothetical protein -
  D1O36_RS08255 (D1O36_08280) - 1529578..1529808 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  D1O36_RS08260 (D1O36_08285) - 1530164..1530364 (-) 201 WP_011681569.1 hypothetical protein -
  D1O36_RS08265 (D1O36_08290) - 1530383..1530559 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  D1O36_RS08270 (D1O36_08295) - 1530810..1531547 (+) 738 WP_134973464.1 response regulator transcription factor -
  D1O36_RS10860 - 1532078..1532881 (+) 804 WP_223899638.1 ATP-binding protein -
  D1O36_RS08280 (D1O36_08305) - 1532899..1533060 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  D1O36_RS08285 (D1O36_08310) - 1533075..1534442 (-) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  D1O36_RS08290 (D1O36_08315) - 1534458..1536610 (-) 2153 Protein_1554 peptide cleavage/export ABC transporter -
  D1O36_RS08305 (D1O36_08330) - 1537624..1539371 (-) 1748 Protein_1555 ABC transporter ATP-binding protein -
  D1O36_RS08310 (D1O36_08335) - 1539364..1541120 (-) 1757 Protein_1556 ABC transporter transmembrane domain-containing protein -
  D1O36_RS10865 (D1O36_08340) - 1541308..1541514 (-) 207 WP_011681579.1 hypothetical protein -
  D1O36_RS08320 (D1O36_08345) - 1541719..1542246 (-) 528 WP_011226503.1 VanZ family protein -
  D1O36_RS08325 (D1O36_08350) rlmN 1542248..1543357 (-) 1110 WP_134973564.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  D1O36_RS08330 (D1O36_08355) - 1543421..1544143 (-) 723 WP_014621927.1 YutD family protein -
  D1O36_RS08335 (D1O36_08360) - 1544204..1545553 (-) 1350 WP_134973466.1 metallophosphatase -
  D1O36_RS08340 (D1O36_08365) - 1545836..1546072 (-) 237 WP_171815042.1 Blp family class II bacteriocin -
  D1O36_RS08345 (D1O36_08370) - 1546402..1547745 (-) 1344 WP_011681583.1 DEAD/DEAH box helicase -
  D1O36_RS08350 (D1O36_08375) mraY 1547820..1548842 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  D1O36_RS08355 (D1O36_08380) pbp2X 1548844..1551111 (-) 2268 WP_071417385.1 penicillin-binding protein PBP2X -
  D1O36_RS08360 (D1O36_08385) ftsL 1551115..1551435 (-) 321 WP_002948801.1 cell division protein FtsL -
  D1O36_RS08365 (D1O36_08390) rsmH 1551438..1552388 (-) 951 WP_014621931.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  D1O36_RS08370 (D1O36_08395) - 1552503..1553201 (-) 699 WP_246752664.1 hypothetical protein -
  D1O36_RS08375 (D1O36_08400) - 1553159..1553545 (-) 387 WP_082245824.1 hypothetical protein -
  D1O36_RS08380 (D1O36_08405) - 1553662..1553910 (-) 249 WP_224102941.1 Wzz/FepE/Etk N-terminal domain-containing protein -
  D1O36_RS08385 (D1O36_08410) - 1554184..1554540 (-) 357 WP_014621938.1 DUF805 domain-containing protein -
  D1O36_RS08390 (D1O36_08415) - 1554758..1555051 (-) 294 WP_232974802.1 hypothetical protein -
  D1O36_RS08395 (D1O36_08420) - 1555386..1556636 (-) 1251 WP_134973470.1 glutamate-5-semialdehyde dehydrogenase -
  D1O36_RS08400 (D1O36_08425) proB 1556638..1557441 (-) 804 WP_002948808.1 glutamate 5-kinase -
  D1O36_RS08405 (D1O36_08430) - 1557562..1559151 (-) 1590 WP_134973472.1 ABC transporter permease -
  D1O36_RS08410 (D1O36_08435) - 1559154..1559886 (-) 733 Protein_1576 ABC transporter ATP-binding protein -
  D1O36_RS08415 (D1O36_08440) - 1560160..1560893 (+) 734 Protein_1577 DUF554 domain-containing protein -
  D1O36_RS08420 (D1O36_08445) addA 1561286..1564939 (-) 3654 WP_134973474.1 helicase-exonuclease AddAB subunit AddA -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39202.09 Da        Isoelectric Point: 9.4944

>NTDB_id=312351 D1O36_RS08095 WP_022096499.1 1501564..1502640(-) (sepM) [Streptococcus thermophilus strain ST106]
MANKTKSKSLLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=312351 D1O36_RS08095 WP_022096499.1 1501564..1502640(-) (sepM) [Streptococcus thermophilus strain ST106]
GTGGCAAACAAGACAAAATCTAAATCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCTACTGACATGATTAAATACGTTCAGGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

PDZ domain (PDZ_2)

(137-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

63.05

95.251

0.601

Multiple sequence alignment