Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D0808_RS18675 Genome accession   NZ_CP031783
Coordinates   3623339..3623479 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MENO2 voucher National Research Centre     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3618339..3628479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0808_RS18650 (D0808_18770) yuxO 3618681..3619061 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  D0808_RS18655 (D0808_18775) comA 3619080..3619724 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D0808_RS18660 (D0808_18780) comP 3619805..3622105 (-) 2301 WP_153256442.1 histidine kinase Regulator
  D0808_RS18665 (D0808_18785) comX 3622117..3622281 (-) 165 WP_015384519.1 competence pheromone ComX -
  D0808_RS18670 (D0808_18790) - 3622294..3623154 (-) 861 WP_064671628.1 polyprenyl synthetase family protein -
  D0808_RS18675 (D0808_18795) degQ 3623339..3623479 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D0808_RS21145 - 3623701..3623763 (+) 63 Protein_3633 hypothetical protein -
  D0808_RS18680 (D0808_18800) - 3623941..3624309 (+) 369 WP_153256443.1 hypothetical protein -
  D0808_RS18685 (D0808_18805) pdeH 3624285..3625514 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  D0808_RS18690 (D0808_18810) pncB 3625651..3627123 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  D0808_RS18695 (D0808_18815) pncA 3627139..3627690 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  D0808_RS18700 (D0808_18820) yueI 3627787..3628185 (-) 399 WP_019712929.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=311335 D0808_RS18675 WP_003220708.1 3623339..3623479(-) (degQ) [Bacillus subtilis strain MENO2 voucher National Research Centre]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=311335 D0808_RS18675 WP_003220708.1 3623339..3623479(-) (degQ) [Bacillus subtilis strain MENO2 voucher National Research Centre]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment