Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilG   Type   Regulator
Locus tag   CJA_RS00390 Genome accession   NC_010995
Coordinates   126864..127259 (-) Length   131 a.a.
NCBI ID   WP_007639219.1    Uniprot ID   -
Organism   Cellvibrio japonicus Ueda107     
Function   regulation of type IV pilus assembly (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 88946..132093 126864..127259 within 0


Gene organization within MGE regions


Location: 88946..132093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJA_RS00235 (CJA_0047) - 88946..89320 (+) 375 WP_012485731.1 Na+/H+ antiporter subunit C -
  CJA_RS00240 (CJA_0048) - 89317..90825 (+) 1509 WP_012485732.1 monovalent cation/H+ antiporter subunit D -
  CJA_RS00245 (CJA_0049) - 90859..91404 (+) 546 WP_012485733.1 Na+/H+ antiporter subunit E -
  CJA_RS00250 (CJA_0050) - 91386..91655 (+) 270 WP_012485734.1 K+/H+ antiporter subunit F -
  CJA_RS00255 (CJA_0051) - 91665..91994 (+) 330 WP_012485735.1 Na+/H+ antiporter subunit G -
  CJA_RS00260 (CJA_0052) - 92074..94611 (-) 2538 WP_012485736.1 heavy metal translocating P-type ATPase -
  CJA_RS00265 (CJA_0053) - 95000..97042 (+) 2043 WP_012485737.1 pectate lyase -
  CJA_RS00270 (CJA_0054) - 97165..97890 (-) 726 WP_012485738.1 lysophospholipid acyltransferase family protein -
  CJA_RS00275 (CJA_0055) gmhB 97906..98478 (-) 573 WP_041550781.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
  CJA_RS00280 (CJA_0056) glyS 98641..100719 (-) 2079 WP_012485740.1 glycine--tRNA ligase subunit beta -
  CJA_RS00285 (CJA_0057) glyQ 100719..101690 (-) 972 WP_012485741.1 glycine--tRNA ligase subunit alpha -
  CJA_RS00290 (CJA_0058) - 101967..102533 (+) 567 WP_012485742.1 CBS domain-containing protein -
  CJA_RS00295 (CJA_0059) - 102734..103408 (-) 675 WP_012485743.1 hypothetical protein -
  CJA_RS00300 (CJA_0060) - 103550..104446 (+) 897 WP_041550783.1 lysophospholipid acyltransferase family protein -
  CJA_RS00305 (CJA_0061) - 104630..105430 (+) 801 WP_012485745.1 ATP-dependent zinc protease -
  CJA_RS00310 (CJA_0062) - 105463..107013 (+) 1551 WP_012485746.1 inactive transglutaminase family protein -
  CJA_RS00315 (CJA_0063) - 107010..108023 (+) 1014 WP_012485747.1 alpha-L-glutamate ligase-like protein -
  CJA_RS00320 (CJA_0064) - 108133..108696 (+) 564 WP_012485748.1 porin family protein -
  CJA_RS00325 (CJA_0066) - 109061..110407 (+) 1347 WP_083766803.1 glycosyltransferase family 4 protein -
  CJA_RS00330 (CJA_0067) - 110394..111143 (+) 750 WP_012485751.1 class I SAM-dependent methyltransferase -
  CJA_RS00335 (CJA_0068) - 111140..112210 (+) 1071 WP_012485752.1 hypothetical protein -
  CJA_RS00340 (CJA_0070) - 112213..112938 (+) 726 WP_012485753.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
  CJA_RS00345 (CJA_0069) - 112935..113285 (-) 351 WP_012485754.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
  CJA_RS00350 (CJA_0071) - 113367..113981 (-) 615 WP_012485755.1 hypothetical protein -
  CJA_RS00355 (CJA_0072) - 114019..114498 (-) 480 WP_012485756.1 chemotaxis protein CheW -
  CJA_RS00360 (CJA_0073) - 114520..115434 (-) 915 WP_238526799.1 chemotaxis protein CheB -
  CJA_RS00365 (CJA_0074) - 115439..122440 (-) 7002 WP_041550786.1 Hpt domain-containing protein -
  CJA_RS00370 (CJA_0075) - 122459..123316 (-) 858 WP_041550789.1 CheR family methyltransferase -
  CJA_RS00375 (CJA_0076) - 123436..125601 (-) 2166 WP_012485760.1 methyl-accepting chemotaxis protein -
  CJA_RS00380 (CJA_0077) - 125707..126249 (-) 543 WP_041550790.1 chemotaxis protein CheW -
  CJA_RS00385 (CJA_0078) pilH 126372..126734 (-) 363 WP_012485762.1 twitching motility response regulator PilH -
  CJA_RS00390 (CJA_0080) pilG 126864..127259 (-) 396 WP_007639219.1 twitching motility response regulator PilG Regulator
  CJA_RS00395 (CJA_0081) gshB 127605..128558 (+) 954 WP_012485764.1 glutathione synthase -
  CJA_RS00400 (CJA_0082) - 128581..129480 (+) 900 WP_012485765.1 energy transducer TonB -
  CJA_RS00405 (CJA_0083) - 129546..130142 (+) 597 WP_049765371.1 YqgE/AlgH family protein -
  CJA_RS00410 (CJA_0084) ruvX 130146..130577 (+) 432 WP_012485767.1 Holliday junction resolvase RuvX -
  CJA_RS00415 (CJA_0085) - 130589..130915 (-) 327 WP_012485768.1 YegP family protein -
  CJA_RS00420 (CJA_0086) pilU 130948..132093 (-) 1146 WP_012485769.1 PilT/PilU family type 4a pilus ATPase Machinery gene

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14472.94 Da        Isoelectric Point: 8.4809

>NTDB_id=31110 CJA_RS00390 WP_007639219.1 126864..127259(-) (pilG) [Cellvibrio japonicus Ueda107]
MEVTYESLKVMVIDDSKTIRRTAETLLKKAGCMVITATDGFDALAKIADTRPDIIFVDIMMPRLDGYQTCALIKNNSEFK
TTPVIMLSSKDGLFDKAKGRIVGSDQYLTKPFSKSELLGAIEAHVKHLKAS

Nucleotide


Download         Length: 396 bp        

>NTDB_id=31110 CJA_RS00390 WP_007639219.1 126864..127259(-) (pilG) [Cellvibrio japonicus Ueda107]
ATGGAAGTAACTTACGAAAGCCTGAAGGTAATGGTTATCGACGACAGCAAAACCATTCGCCGCACGGCTGAAACCCTGTT
AAAAAAAGCGGGCTGCATGGTGATTACCGCCACCGATGGCTTTGATGCCCTGGCAAAAATCGCTGATACCCGCCCCGACA
TCATTTTCGTCGATATCATGATGCCGCGCCTCGATGGCTATCAAACCTGTGCATTAATCAAAAACAATAGCGAATTCAAA
ACCACCCCTGTCATTATGCTCTCCAGCAAAGACGGGCTATTCGATAAGGCCAAGGGGCGCATTGTTGGCTCCGACCAATA
CCTGACCAAACCCTTTAGTAAAAGTGAGCTGCTGGGCGCTATTGAGGCCCACGTCAAGCATTTGAAAGCCTCCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilG Acinetobacter baumannii strain A118

76

95.42

0.725

  vicR Streptococcus mutans UA159

43.22

90.076

0.389


Multiple sequence alignment